Однолинейная схема онлайн конструктор: Онлайн программа для создания линейной электросхемы. Как нарисовать схему онлайн

Содержание

Нарисовать Однолинейную Электрическую Схему — tokzamer.ru

Всё ещё проще: потыкайте на такую фигуру мышкой несколько раз.


Поэтому удобне начинать документ из шаблонов, которые сам же Visio и предлагает.

Теперь можно показать то, как я Visio применяю. Тогда стоит поиграться размерами самой страницы Visio!
Конструктор однолинейных схем. Описание работы.

Очень удобно! Учитывая их, меняются характеристики элементов, где были выявлены дефекты и рассчитываются новые, по результатом которых происходит замена тех составных частей, которые мешают нормальному электрическому снабжению помещения.

При условии, что эти Как и в Автокаде, для этого надо выставить настройки печати.

Я говорил вам о том, что в Visio можно сделать так, чтобы оперировать реальными размерами на листе А4.

Идём дальше! Но при этом будут очень занижены ее возможности, что экономически не рационально.

Встроенная в графический редактор, помощь подробно объясняет особенности алгоритмов.

Черчение электрических схем по ГОСТ в Visio

Описание панели инструментов для рисования электрических схем.

Это может сгодиться, чтобы подсчитать какие-то расстояния или проверить, влезет ли диван шириной в 1,97 метра между шкафом шириной в 0,8 метра и столом шириной в 1,58 метра. Документ в Visio может состоять из нескольких страниц.

Пример оформления однолинейной схемы электроснабжения промышленного предприятия Виды однолинейных электрических схем В зависимости от того, на каком этапе выполнения работ по созданию электрической сети объекта составляется однолинейная схема, зависит её вид и прямое предназначение.

Ну и на последней значимой для нас вкладке можно настроить название страницы и выбрать её тип передняя или подложка — про это будет позже и задать единицы измерения.

При этом все приборы и электрические элементы на схеме имеют определенное обозначение, которое установлено ГОСТом. Это очень удобно, потому что можно будет печатать разные документы из одного файла, если захочется держать весь проект рядом.


А если рисуете план дома — то миллиметры, как это принято в строительстве.

В стандартных библиотеках есть куча разных удобных символов и заготовок. Мясо чуть посложнее.

А если футбольное поле или дачный участок — то играемся так, как хотим.
Схема электрическая принципиальная

Особенности электроснабжения

А если хочется — то можно наоборот, привести обычный лист А4 к размерам х метров и чертить на нём какой-нибудь план футбольного стадиона или чего-то огромного. Если нажать на эту полоску — то открывается группа, которая под ней спрятана.

Работа в Rapsodie существенно ускоряет процесс компоновки шкафа. А это — зверство с проектом стапеля для сборки щитов на него ушло около часа — это большое время по меркам Visio : Рисунок сделан из кучи сгруппированных блоков:крепления, одна панель щита с двумя несущими профилями. Поэтому в ней можно создавать графические элементы для вставки в текстовые документы.


Для работы Вы можете использовать только мышку, разработать и распечатать схему электрического щитка и этикетки с обозначениями элементов схемы для щитка. Это нужно, когда мы хотим отрисовать сложный объект.

Также есть возможность создавать персональный каталог из устройств, которых нет в базе данных программы. Кстати, что это за точечка и квадратики вокруг фигуры? Этапы проектирования Особенности электроснабжения Значение линейной схемы трудно переоценить. Помогают они оценить и общую безопасность.

Ну, блин, нарисуйте блок-схему на куске бумажки, если не умеете рисовать. Все эти настройки тыкаются или кнопками на панели инструментов, или через контекстное меню по правой кнопке: Можно выписать вот так: Текст — отвечает за параметры шрифта, которым на фигуре что-то пишется. Обозначения условные графические в электрических схемах.

Программы для рисования электрических схем


А это не всегда получится: некоторые фигуры сразу ставятся размерами кратко текущему масштабу документа и потом эти размеры нельзя поменять. Заставил нарисовать блок-схему на листке бумаги. А чтобы правильно на схеме их обозначить, необходимо изучить ГОСТ.

Здесь я нарисовал элементы электропроводки: А здесь нарисовал трассы кабелей электропроводки, не меняя фона. Для более удобного использования в плане применения однолинейная схема электроснабжения может быть двух видов: исполнительная; расчётная. Так как в них шикарный интерфейс, есть все функции и электрические обозначения. Первый вид проектируется при наличие действующих электрических систем. Всё, чего нет — можно напрограммировать.

Для создания документа на компьютере необходимо программное обеспечение — графический редактор, который преобразует манипуляции пользователя ПК на устройстве ввода информации в чертеж. Важно помнить, что при необходимости расчетная часть исполнительной однолинейной схемы может быть увеличены в несколько раз. Такой вариант крайне удобен в использовании даже для непрофессионала, одновременно являясь функциональным и эффективным. В этих единицах Visio будет показывать вам все размеры.
Проектирование электрощитов. Visio в помощь + Библиотека.

Что такое однолинейная схема электроснабжения

Это способ, при помощи которого Visio видит несколько фигур как одно целое и квадратики для изменения размеров и поворота появляются одни на общую фигуру.

Здесь тоже можно создать часто используемые обозначения элементов в качестве шаблонов для применения их при дальнейшей работе.

Вот люди и делали такой чертёж, чтобы он занимал ровно один лист А4 из, скажем, 16ти. И всё это — Visio!

Данный вид схемы применяется для уже действующего электроснабжения любого помещения. Для этого не надо устанавливать никаких дополнительных программ. Такие схемы нужны для исправления неполадок и дефектов.

Функциональные — применяются в случаях, когда имеется большое количество различных потребителей машин, станков, оборудования , и отображают общую картину сети и взаимодействие между механизмами, электроснабжением и друг с другом. Их число особо не ограничено. Этапы проектирования Особенности электроснабжения Значение линейной схемы трудно переоценить. Эта простота заключается в том, что весь комплекс компонентов, необходимых для снабжения электричеством потребителей, на ней изображаются несколькими линиями.

Такие положения фигур по оси Z действуют в пределах документа и сгруппированных фигур. Эта программа замечательно подойдет для домашнего рисования всех схем. При условии, что эти

Оформить заявку

На этапе разработки проектной документации составляется расчётная однолинейная схема, служащая основным документом для расчёта параметров системы электроснабжения. По вопросам пишите на электронную почту: info el-proekt. А в блок-схеме это просто и понятно.

Однолинейная схема — это графическое изображение 2-ух или трехфазной сети, которая объединяет все устройства электрической цепи при помощи одной линии,что позволяет достаточно сильно упростить чертежи и планы. В стандартных библиотеках есть куча разных удобных символов и заготовок. Для редактирования изображений используется масштабирование, работа с окнами и слоями, перемещение, вставка разрывов, вращение, изменение отражения, наложение текста, цветовая палитра и другие функции и стили. Форматирование похоже на Word: Visio умеет разделять абзацы, делать там отступы и выравнивание. Вот фотка утащена из журнала Lana-Sator и сохранена копией на хостинге; спасибо, Лана!

Как читать Элекрические схемы

Программа для черчения однолинейных схем электроснабжения

Мы все больше пользуемся компьютером и виртуальными инструментами. Вот уже и чертить на бумаге схемы не всегда хочется — долго, не всегда красиво и исправлять сложно. Кроме того, программа для рисования схем может выдать перечень необходимых элементов, смоделировать печатную плату, а некоторые могут даже просчитать результаты ее работы.

Бесплатные программы для создания схем

В сети имеется немало неплохих бесплатных программ для рисования электрических схем. Профессионалам их функционала может быть недостаточно, но для создания схемы электроснабжения дома или квартиры, их функций и операций хватит с головой. Не все они в равной мере удобны, есть сложные в освоении, но можно найти несколько бесплатных программ для рисования электросхем которыми сможет пользоваться любой, настолько в них простой и понятный интерфейс.

Самый простой вариант — использовать штатную программу Windows Paint, которая есть практически на любом компьютере. Но в этом случае вам придется все элементы прорисовывать самостоятельно. Специальная программа для рисования схем позволяет вставлять готовые элементы на нужные места, а потом соединять их при помощи линий связи. ОБ этих программах и поговорим дальше.

Бесплатная программа для рисования схем — не значит плохая. На данном фото работа с Fritzing

Редактор электрических схем QElectroTech

Программа для рисования схем QElectroTech есть на русском языке, причем русифицирована она полностью — меню, пояснения — на русском языке. Удобный и понятный интерфейс — иерархическое меню с возможными элементами и операциями в левой части экрана и несколько вкладок вверху. Есть также кнопки быстрого доступа для выполнения стандартных операций — сохранения, вывода на печать и т.п.

Редактор электрических схем QElectroTech

Имеется обширный перечень готовых элементов, есть возможность рисовать геометрические фигуры, вставлять текст, вносить изменения на определенном участке, изменять в каком-то отдельно взятом фрагменте направление, добавлять строки и столбцы. В общем, довольно удобна программа при помощи которой легко нарисовать схему электроснабжения, проставить наименование элементов и номиналы. Результат можно сохранить в нескольких форматах: JPG, PNG, BMP, SVG, импортировать данные (открыть в данной программе) можно в форматах QET и XML, экспортировать — в формате QET.

Недостаток этой программы для рисования схем — отсутствие видео на русском языке о том, как ей пользоваться, зато есть немалое количество уроков на других языках.

Графический редактор от Майкрософт — Visio

Для тех, кто имеет хоть небольшой опыт работы с продуктами Майкрософт, освоить работу в из графическом редакторе Visio (Визио) будет несложно. У данного продукта также есть полностью русифицированная версия, причем с хорошим уровнем перевода.

Составлять электрические схемы в Visio несложно

Данный продукт позволяет начертить схему в масштабе, что удобно для расчета количества необходимых проводов. Большая библиотека трафаретов с условными обозначениями, различных составляющих схемы, делает работу похожей на сборку конструктора: необходимо найти нужный элемент и поставить его на место. Так как к работе в программах данного типа многие привыкли, сложности поиск не представляет.

К положительным моментам можно отнести наличие приличного количества уроков по работе с этой программой для рисования схем, причем на русском языке.

Компас Электрик

Еще одна программа для рисования схем на компьютере — Компас Электрик. Это уже более серьезный продукт, который используют профессионалы. Имеется широкий функционал, позволяющий рисовать различные планы, блок-схемы, другие подобные рисунки. При переносе схемы в программу параллельно формируется спецификация и монтажная схема и све они выдаются на печать.

Для начала работы необходимо подгрузить библиотеку с элементами системы. При выборе схематичного изображения того или иного элемента будет «выскакивать» окно, в котором будет список подходящих деталей, взятый из библиотеки. Из данного списка выбирают подходящий элемент, после чего его схематичное изображение появляется в указанном месте схемы. В то же время автоматически проставляется соответствующее ГОСТу обозначение со сквозной нумерацией (цифры программа меняет сама). В то же время в спецификации появляются параметры (название, номер, номинал) выбранного элемента.

Пример схемы, созданной в Компас Электрик

В общем, программа интересная и полезная для разработки схем устройств. Может применяться для создания схемы электропроводки в доме или квартире, но в этом случае ее функционал использован почти не будет. И еще один положительный момент: есть много видео-уроков работы с Компас-Электрик, так что освоить ее будет несложно.

Программа DipTrace — для рисования однолинейных схем и принципиальных

Эта программа полезна не только для рисования схем электроснабжения — тут все просто, так как нужна только схема. Более полезна она для разработки плат, так как имеет встроенную функцию преобразования имеющейся схемы в трассу для печатной платы.

Для начала работы, как и в многих других случаях, необходимо сначала подгрузить имеющиеся на вашем компьютере библиотеки с элементной базой. Для этого необходимо запустить приложение Schematic DT, после чего можно загрузить библиотеки. Их можно будет скачать на том же ресурсе, где будете брать программу.

После загрузки библиотеки можно приступать к рисованию схемы. Сначала можно «перетащить» нужные элементы из библиотек на рабочее поле, развернуть их (если понадобится), расставить и связать линиями связи. После того как схема готова, если необходимо, в меню выбираем строку «преобразовать в плату» и ждем некоторое время. На выходе будет готовая печатная плата с расположением элементов и дорожек. Также можно в 3D варианте посмотреть внешний вид готовой платы.

Бесплатная прога ProfiCAD для составления электросхем

Бесплатная программа для рисования схем ProfiCAD — один из лучших вариантов для домашнего мастера. Она проста в работе, не требует наличия на компьютере специальных библиотек — в ней уже есть коло 700 элементов. Если их недостаточно, можно легко пополнить базу. Требуемый элемент можно просто «перетащить» на поле, там развернуть в нужном направлении, установить.

Пример использования ProfiCAD для рисования электрических схем

Отрисовав схему, можно получить таблицу соединений, ведомость материалов, список проводов. Результаты можно получить в одном из четырех наиболее распространенных форматов: PNG, EMF, BMP, DXF. Приятная особенность этой программы — она имеет низкие аппаратные требования. Она нормально работает с системами от Windows 2000 и выше.

Есть у этого продукта только один недостаток — пока нет видео о работе с ней на русском языке. Но интерфейс настолько понятный, что разобраться можно и самому, или посмотреть один из «импортных» роликов чтобы понять механику работы.

Платные, на которые стоит потратиться

Если вам придется часто работать с программой для рисования схем, стоит рассмотреть некоторые платные версии. Чем они лучше? У них более широкий функционал, иногда более обширные библиотеки и более продуманный интерфейс.

Простая и удобная sPlan

Если вам не очень хочется разбираться с тонкостями работы с многоуровневыми программм, присмотритесь к пролукту sPlan. Он имеет очень простое и понятное устройство, так что через час-полтора работы вы будете уже свободно ориентироваться.

Как обычно в таких программах, необходима библиотека элементов, после первого пуска их надо подгрузить перед началом работы. В дальнейшем, если не будете переносить библиотеку в другое место, настройка не нужна — старый путь к ней используется по умолчанию.

Программа для рисования схем sPlan и ее библиотека

Если вам необходим элемент, которого нет в списке, его можно нарисовать, затем добавить в библиотеку. Также есть возможность вставлять посторонние изображения и сохранять их, при необходимости, в библиотеке.

Из других полезных и нужных функций — автонумерация, возможность изменения масштаба элемента при помощи вращения колесика мышки, линейки для более понятного масштабирования. В общем, приятная и полезная вещь.

Micro-Cap

Эта программа кроме построения схемы любого типа (аналогового, цифрового или смешанного) позволяет еще и проанализировать ее работу. Задаются исходные параметры и получаете выходные данные. То есть, можно моделировать работу схемы при различных условиях. Очень полезная возможность, потому, наверное, ее очень любят преподаватели, да и студенты.

В программе Micro-Cap есть встроенные библиотеки, которые можно пополнять при помощи специальной функции. При рисовании электрической схемы продукт в автоматическом режиме разрабатывает уравнения цепи, также проводит расчет в зависимости от проставленных номиналов. При изменении номинала, изменение выходных параметров происходит тут же.

Программа для черчения схем электроснабжения и не только — больше для симуляции их работы

Номиналы элементов могут быть постоянными или переменными, зависящими от различных факторов — температуры, времени, частоты, состояния некоторых элементов схемы и т.д. Все эти варианты просчитываются, результаты выдаются в удобном виде. Если есть в схеме детали, которые изменяют вид или состояние — светодиоды, реле — при симуляции работы, изменяют свои параметры и внешний вид благодаря анимации.

Программа для черчения и анализа схем Micro-Cap платная, в оригинале — англоязычная, но есть и русифицированная версия. Стоимость ее в профессиональном варианте — больше тысячи долларов. Хороша новость в том, что есть и бесплатная версия, как водится с урезанными возможностями (меньшая библиотека, не более 50 элементов в схеме, сниженная скорость работы). Для домашнего пользования вполне подойдет и такой вариант. Приятно еще что она нормально работает с любой системой Windows от Vista и 7 и выше.

Времена применения кульманов давно миновали, их заменили графические редакторы, это специальные программы для черчения электрических схем. Среди них есть как платные приложения, так и бесплатные (виды лицензий мы рассмотрим ниже). Уверены, что созданный нами краткий обзор поможет из разнообразия программных продуктов выбрать ПО, наиболее оптимальное для поставленной задачи. Начнем с бесплатных версий.

Бесплатные

Прежде, чем перейти к описанию программ кратко расскажем о бесплатных лицензиях, наиболее распространены из них следующие:

  • Freeware – приложение не ограничено по функциональности и может использоваться в личных целях без коммерческой составляющей.
  • Open Source – продукт с «открытым кодом», в который допускается вносить изменения подстраивая ПО под собственные задачи. Возможны ограничения на коммерческое использование и платное распространение внесенных модификаций.
  • GNU GPL – лицензия практически не накладывающая на пользователя никаких ограничений.
  • Public domain – практически идентична с предыдущим вариантом, на данный тип лицензии закон защиты авторских прав не распространяется.
  • Ad-supported – приложение полностью функционально, содержит в себе рекламу других продуктов разработчика или других компаний.
  • Donationware – продукт распространяется бесплатно, но разработчик предлагает внести пожертвования на добровольной основе для дальнейшего развития проекта.

Получив представление о бесплатных лицензиях можно переходить к ПО, распространяемому на таких условиях.

Microsoft Visio

Это простой в управлении, но в то же время весьма удобный редактор векторной графики, обладающий богатым функциональным набором. Несмотря на то, что основная социализация программы визуализация информации с приложений MS Office, ее вполне можно использовать для просмотра и распечатки радиосхем.

Интерфейс Microsoft Visio практически такой же, как в MS Office

MS выпускает три платных версии, отличающихся функциональным набором и бесплатную (Viewer), которая интегрируется в браузер IE и позволяет с его помощью осуществлять просмотр файлов, созданных в редакторе. К сожалению, для редакции и создания новых схем потребуется приобрести полнофункциональный продукт. Заметим, что даже в платных версиях среди базовых шаблонов нет набора для полноценного создания радиосхем, но его несложно найти и установить.

Недостатки бесплатной версии:

  • Недоступны функции редактирования и создания схем, что существенно снижает интерес к этому продукту.
  • Программа работает только с браузером IE, что также создает массу неудобств.

Компас-Электрик

Данная ПО является приложением к САПР российского разработчика «АСКОН». Для ее работы требуется установка среды КОМПАС-3D. Поскольку это отечественный продукт, в нем полностью реализована поддержка принятых России ГОСТов, и, соответственно, нет проблем с локализацией.

Компас-Электрик – полностью российская разработка

Приложение предназначено для проектирования любых видов электрооборудования и создания к ним комплектов конструкторской документации.

Это платное ПО, но разработчик дает 60 дней на ознакомление с системой, в течение этого времени ограничения по функциональности отсутствуют. На официальном сайте и в сети можно найти множество видео материалов, позволяющих детально ознакомиться с программным продуктом.

В отзывах многие пользователи отмечают, что в системе имеется масса недоработок, которые разработчик не спешит устранять.

Eagle

Данное ПО представляет собой комплексную среду, в которой можно создать как принципиальную схему, так и макет печатной платы к ней. То есть, расположить на плате все необходимые элементы и выполнить трассировку. При этом, она может быть выполнена как в автоматическом, так и ручном режиме или путем комбинации этих двух способов.

Cadsoft Eagle – хороший пример комплексного решения

В базовом наборе элементов отсутствуют модели отечественных радиокомпонентов, но их шаблоны могут быть скачены в сети. Язык приложения – Английский, но локализаторы, позволяющие установить русский язык.

Приложение является платным, но возможность его бесплатного использования со следующими функциональными ограничениями:

  • Размер монтажной платы не может превышать размера 10,0х8,0 см.
  • При разводке можно манипулировать только двумя слоями.
  • В редакторе допускается работа только с одним листом.

Dip Trace

Это не отдельное приложение, а целый программный комплекс, включающий в себя:

  • Многофункциональный редактор для разработки принципиальных схем.
  • Приложение для создания монтажных плат.
  • 3D модуль, позволяющий проектировать корпуса для созданных в системе приборов.
  • Программу для создания и редактирования компонентов.

DipTrace – система сквозного проектирования

В бесплатной версии программного комплекса, для некоммерческого использования, предусмотрены небольшие ограничения:

  • Монтажная плата не более 4-х слоев.
  • Не более одной тысячи выводов с компонентов.

В программе не предусмотрена русская локализация, но ее, а также описание всех функций программного продукта можно найти в сети. С базой компонентов также нет проблем, в изначально их около 100 тыс. На тематических форумах можно найти созданные пользователями базы компонентов, в том числе и под российские ГОСТы.

1-2-3 схема

Это полностью бесплатное приложение, позволяющее укомплектовать электрощиты Хагер (Hager) одноименным оборудованием.

ПО «1-2-3 схема» разработка компании Hager для комплектации своих электрощитов

Функциональные возможности программы:

  • Выбор корпуса для электрощита, отвечающего нормам по степени защиты. Выборка производится из модельного ряда Hager.
  • Комплектация защитным и коммутационным модульным оборудованием того же производителя. Заметим, что в элементной базе присутствуют только сертифицированные в России модели.
  • Формирование конструкторской документации (однолинейной схемы, спецификации, отвечающей нормам ЕСКД, отрисовка внешнего вида).
  • Создание маркеров для коммутирующих устройств электрощита.

Программа полностью локализована под русский язык, единственный ее недостаток, что в элементной базе присутствует только электрооборудование компании-разработчика.

Autocad Electrical

Приложение на базе известной САПР Autocad, созданное для проектирования электросхем и создания для них технической документации в соответствии с нормами ЕСКД.

В Autocad Electrical богатый выбор электрических компонентов

Изначально база данных включает в себя свыше двух тысяч компонентов, при этом, их условно графические обозначения отвечают действующим российским и европейским стандартам.

Данное приложение платное, но имеется возможность в течение 30-ти дней ознакомиться с полным функционалом базовой рабочей версии.

Данное ПО позиционируется в качестве автоматизированного рабочего места (АРМ) для проектировщиков-электриков. Приложение позволяет быстро и корректно разработать, практически, любой чертеж для электротехнических проектов с привязкой к плану помещений.

Функционал приложения включает в себя:

  • Расстановку УГО при проектировании электросетей, проложенных открыто, в трубах или специальных конструкциях.
  • Автоматический (с плана) или руной расчет силовой схемы.
  • Составление спецификации в соответствии с действующими нормами.
  • Возможность расширения базы элементов (УГО).

Пример схемы, созданной в редакторе Эльф

В бесплатной демонстрационной версии отсутствует возможность создания и редактирование проектов, их можно только просмотреть или распечатать.

Kicad

Это полностью бесплатный программный комплекс с открытым кодом (Open Source). Данное ПО позиционируется в качестве системы сквозного проектирования. То есть, можно разработать принципиальную схему, по ней создать монтажную плату и подготовить документацию, необходимую для производства.

KiCad одна из немногих бесплатных систем сквозного проектирования

Характерные особенности системы:

  • Для разводки платы допускается применение внешних трассировщиков.
  • В программу встроен калькулятор печатной платы, размещение на ней элементов можно выполнить автоматически или вручную.
  • По завершению трассировки система генерирует несколько технологических файлов (например, для фотоплоттера, сверлильного станка и т.д.). При желании можно добавить логотип компании на печатную плату.
  • Система может создать послойную распечатку в нескольких популярных форматах, а также сгенерировать список используемых в разработке компонентов для формирования заказа.
  • Имеется возможность экспорт чертежей и других документов в форматы pdf и dxf.

Заметим, что многие пользователи отмечают непродуманность интерфейса системы, а также тот факт, что для освоения ПО требуется хорошо изучить документацию к программе.

TinyCAD

Еще одно бесплатное приложение с открытым кодом, позволяющее создавать чертежи принципиальных схем и имеющее функции простого редактора векторной графики. В базовом наборе содержится сорок различных библиотек компонентов.

TinyCAD – простой редактор для принципиальных схем

В программе не предусмотрена трассировка печатных плат, но имеется возможность экспортировать список соединений в стороннее приложение. Экспорт производится с поддержкой распространенных расширений.

Приложение поддерживает только английский язык, но благодаря интуитивному меню проблем с освоением не возникнет.

Fritzing

Бесплатная среда разработки проектов на базе Arduino. Имеется возможность создания печатных плат (разводку необходимо делать вручную, поскольку функция автотрассировки откровенно слабая).

Приложение Fritzing позволит быстро спроектировать любое устройство на базе Arduino

Следует заметить, что приложение «заточено» для быстрого создания набросков, позволяющих объяснить принцип работы проектируемого прибора. Для серьезной работы у приложения слишком мала база элементов и сильно упрощенное составление схемы.

123D Circuits

Это веб-приложение для разработки Arduino-проектов, с возможностью программирования устройства, симуляции и анализа его работы. В типовом наборе элементов присутствуют только основные радио-компоненты и модули Arduino. При необходимости пользователь может создать новые компоненты и добавить их в базу. Примечательно, что разработанную печатную плату можно заказать, непосредственно, в онлайн-сервисе.

Виртуальная среда разработки 123D Circuits

В бесплатной версии сервиса нельзя создавать свои проекты, но можно просматривать чужие разработки, находящиеся в открытом доступе. Для полноценного доступа ко всем возможностям необходимо оформить подписку ($12 или $24 в месяц).

Заметим, что из-за бедного функционала виртуальная среда разработки вызывает интерес только у начинающих. Многие из тех, кто пользовался сервисом, обратили внимание на тот факт, что результаты симуляции расходятся с реальными показателями.

XCircuit

Бесплатное мультиплатформенное приложение (лицензия GNU GPL) для быстрого создания принципиальных схем. Функциональный набор минимальный.

XCircuit – простой редактор с минимумом функций

Язык приложения – английский, программа не воспринимает русские символы. Также следует обратить внимание на нетипичное меню, к которому необходимо привыкнуть. Помимо этого контекстные подсказки выводятся на панель состояния. В базовый набор элементов входят УГО только основных радиодеталей (пользователь может создать свои элементы и добавить их).

CADSTAR Express

Это демонстрационная версия одноименной САПР. Функциональные ограничения коснулись лишь числа элементов, используемых в схеме разработки (до 50 шт) и количеств контактов (не более 300), что вполне достаточно для небольших радиолюбительских проектов.

Фрагмент рабочего окна приложения GADSTAR Express

Программа состоит из центрального модуля, в которых входит несколько приложений позволяющих разработать схему, создать для нее плату и подготовить пакет технической документации.

В базовый набор входит более 20 тыс. компонентов, дополнительно можно загрузить с сайта разработчика дополнительные библиотеки.

Существенным недостатком системы является отсутствие поддержки русского языка, соответственно, все техническая документация также представлена в сети на английском.

QElectroTech

Простое удобное и бесплатное (FreeWare) приложения для разработки электрических и электронных схем-чертежей. Программа является обычным редактором, никаких специальных функций в ней не реализовано.

QElectroTech – программа для составления, просмотра и печати электросхем

Язык приложения – английский, но для него имеется русская локализация.

Платные приложения

В отличие от ПО, распространяемого по бесплатным лицензиям, коммерческие программы, как правило, обладают значительно большим функционалом, и поддерживаются разработчиками. В качестве примера мы приведем несколько таких приложений.

sPlan

Простая программа-редактор для черчения электросхем. Приложение комплектуется несколькими библиотеками компонентов, которые пользователь может расширять по мере необходимости. Допускается одновременная работа с несколькими проектами, путем их открытия в отдельных вкладках.

sPlan – удобный графический редактор для электрических схем

Чертежи, сделанные программой, хранятся в виде файлов векторной графики собственного формата с расширением «spl». Допускается конвертация в типовые растровые форматы изображения. Имеется возможность печати больших схем на обычном принтере А4-го формата.

Официально приложение не выпускается в русской локализации, но существуют программы, позволяющие русифицировать меню и контекстные подсказки.

Помимо платной версии предусмотрены две бесплатных реализации Demo и Viewer. В первой нет возможности сохранить и распечатать нарисованную схему. Во второй предусмотрена только функция просмотра и печати файлов формата «spl».

Eplan Electric

Многомодульная масштабируемая САПР для разработки электротехнических проектов различной сложности и автоматизации процесса подготовки конструкторской документации. Данный программный комплекс сейчас позиционируется в качестве корпоративного решения, поэтому для рядовых пользователей он будет не интересен, особенно если принять в учет стоимость ПО.

Фрагмент рабочего окна САПР Eplan Electriс Р8

Target 3001

Мощный САПР комплекс, позволяющий разрабатывать электросхемы, трассировать печатные платы, моделировать работу электронных устройств. Онлайн библиотека компонентов насчитывает более 36 тыс. различных элементов. Данная CAD широко применяется в Европе для трассировки печатных плат.

САПР Target 3001

По умолчанию устанавливается английский язык, имеется возможность установить меню на немецком или французском, официально русской локализации нет. Соответственно, вся документация представлена только на английском, французском или немецком языке.

Стоимость самой простой базовой версии около 70 евро. За эти деньги будет доступна трассировка двух слоев на 400 выводов. Стоимость нелимитированной версии в районе 3,6 тыс. евро.

Micro-Cap

Приложение для моделирования цифровых, аналоговых и смешанных схем, а также анализа их работы. Пользователь может создать в редакторе электрическую цепь и задать параметры для анализа. После это по одному клику мышки система автоматически чего произведет необходимые расчеты и выдаст результаты для изучения.

Micro-Cap – одно из лучших приложений для моделирования электросети

Программа позволяет установить зависимость параметров (номиналов) элементов от температурного режима, освещенности, частотных характеристик и т.д. Если в схеме присутствуют анимированные элементы, например, светодиодные индикаторы, то их состояние будут корректно отображаться, в зависимости от поступающих сигналов. Имеется возможность при моделировании «подключать» к схеме виртуальные измерительные приборы, а также отслеживать состояние различных узлов устройства.

Стоимость полнофункциональной версии около $4,5 тыс. Официальной русской локализации приложения не существует.

TurboCAD

Данная САПР платформа включает в себя множество инструментов, для проектирования различных электрических устройств. Набор специальных функций позволяет решать инженерно-конструкторские задачи любого уровня сложности.

Платформа TurboCAD может использоваться для решения многих задач

Отличительные особенности – тонкая настройка интерфейса под пользователя. Множество справочной литературы, в том числе и на русском языке. Несмотря на отсутствие официальной поддержки русского языка, для платформы имеются русификаторы.

Для рядовых пользователей приобретение платной версии программы с целью разработки электросхем для любительских устройств, будет нерентабельно.

Designer Schematic

Приложение для создания электросхем с использованием радиоэлементов производства Digi-Key. Основная особенность данной системы заключается в том, что в редакторе для построения схем, может использовать механическое проектирование.

Интерфейс Designer Schematic не отличается сложностью

Базы данных компонентов можно в любой момент проверить на соответствие и при необходимости произвести обновление прямо с сайта производителя.

Система не имеет собственного трассировщика, но список соединений может быть загружен в стороннюю программу.

Имеется возможность импорта файлов из популярных САПР.

Ориентировочная стоимость приложения около $300.

Электрики уже не используют циркуль и рейсшину, чтобы вручную составить сложную и запутанную систему линий и кабелей. Это не только долго и трудоемко, но и не всегда красиво и чисто. К тому же любой человек склонен к ошибкам, в работе с чертежами это особенно заметно: неточность на бумаге выливается в реальную опасность для использования электросистемы пользователями. Проектирование электрических схем стало доступнее после того, как были разработаны специальные программы для построения и моделирования электропроводки в доме или квартире. В этой статье мы расскажем о необходимости САПРов, положительных и отрицательных сторонах самых популярных из них.

Плюсы проектирования чертежей на компьютере

  • Платформы для создания электросхем призваны облегчить процесс создания точных чертежей. Машина произведет за вас расчеты на основании тех данных, которые вы занесете. Любое изделие, выполненное в хорошем проектировщике, пройдет автоматическое тестирование.
  • Многие ПО включают в себя разнообразную базу. Готовые макеты, которые нужно лишь дополнить и подогнать под себя. Все элементы, находящиеся в библиотеке, отвечают стандартам черчения. Используя их в работе, вы облегчаете свою задачу и не тратите время на повторное рисование классических блоков электросети.
  • Расширенный функционал делает компьютерный аналог карандаша и линейки намного эргономичнее. Не надо иметь ворох бумажных чертежей с различными деталями, когда в программе для разработки электрических схем можно нажать пару кнопок, чтобы сравнить разные страницы. Используя новые технологии, инженеру становится легче работать: нет необходимости рисовать массу чертежей, на которых отличаются лишь показатели, компьютер сделает это за вас. ZWCAD решает эту проблему, предлагая пользователю вставку выбранных объектов с различными параметрами из палитры свойств.
  • Очень удобно хранить проект в электронном виде. Его можно послать по почте коллегам, доработать или исправить при необходимости. При этом не понадобится заново делать чертеж. Когда работа будет завершена, план можно будет распечатать в любом масштабе.
  • В любом проекте есть элементы, которые не требуют творческого подхода. Они стандартные и несложные, но также тратят время разработчика. На помощь приходят автоматические системы проектирования САПР. С ними вся работа или ее часть будет выполнена за доли секунды.
  • Любой потребитель найдет свой продукт. Для составления простенькой схемы разводки дома подойдет бесплатный вариант программы для электрика. Такое ПО имеет меньший функционал и открывает более скромные возможности, но иногда для выполнения несложной задачи большего и не требуется. Специалист тоже подберет софт для себя: с обширными ресурсами и технологически грамотным интерфейсом. Не всегда дороговизна продукта – показатель качества. Популярные компании, занимающие высокое положение среди своих аналогов, завышают цену, уступая в разнообразии свойств своим более молодым конкурентам.
  • Качество европейских стандартов остается, но использование становится удобным для среднестатистического проектировщика, потому что большинство новых программ для создания электрических схем предлагают интерфейс на русском языке.
  • Существуют разработки, направленные на конкретную специальность. Инструментарий в них подобран под определенную деятельность, например, для конструирования больших зданий, промышленных объектов или жилых домов. Некоторые фирмы предлагают дополнительные модули, расширяющие функционал стандартного пакета.
  • Многие компании предлагают периодические обновления, так единожды купленная платформа останется актуальной на протяжении многих лет.

В каких случаях подходит софт

Программа нужна для рисования, проектирования, черчения однолинейных схем электроснабжения дома. Она представляет собой документ для графического конструирования. Ее инструментарий содержит входящие в структуру устройства элементы и контакты между ними. Благодаря условным обозначениям удобно находить и применять все средства, доступные при разработке. Сам чертеж – часть всего пакета документов, связанных с проектом. В нем содержатся данные для монтажа, координации и управления устройством.

Для каких этапов предназначена программа для чертежа электрических схем

Она незаменима на всех стадиях осуществления электроснабжения:

  1. Составление проекта. Модель дает возможность установить составные части разрабатываемого продукта.
  2. Процесс производства. На чертежах можно продемонстрировать устройство. На их основе рассчитываются все этапы создания, установки и проверки системы.
  3. Период эксплуатации. Если проявился дефект или произошла поломка, благодаря чертежу можно обнаружить причину и понять, как ее устранить.

Как нарисовать однолинейную схему электроснабжения

Это основной вид планирования. Его обычно используют при конструировании несложных проектов. Такой способ отличается от остальных моделей простотой создания: весь набор составляющих, необходимых для поставки электричества потребителям, на ней отображается несколькими линиями.

Основные этапы разработки проекта при помощи программы для создания, рисования, черчения электросхем:

  • Первоначальный и наиболее важный этап – сбор и подготовка расчетно-вычислительных материалов. Важна точность подсчетов.
  • Если система была в использовании, необходимо визуальное и техническое диагностирование электросистемы, изучение характеристик и выявление дефектов и поломок сети. По результатам обследования нужно составить смету тех частей, которые необходимо заменить. Эти данные входят в отчет и учитываются при проектировании. Если вся электросеть требует реконструкции, расчет приходится производить заново.
  • С собранными материалами можно приступать к чертежу. От правильности этого этапа зависит безопасность владельца и пользователей помещения. Точность исполнения можно возложить на специализированные программы для проектирования электрики.

Компания ZWSOFT предлагает для пользователей любой версии ZWCAD поддержку технических специалистов. Они ответят на ваши вопросы, связанные с использованием софта. На сайте разработчика есть статьи и видео, созданные для помощи клиентам.

  • Заключительной ступенью перед началом монтажа является согласование проекта в службе эксплуатации. Если все одобрено, можно приступать к установке.

Соблюдение всех правил является принципиальным при приготовлении здания к электрификации. От этого зависит нормальное функционирование всего энергоснабжения, возможность долгой эксплуатации без ремонта и замены деталей и, конечно, здоровье и безопасность потребителей.




Какие программы проектирования систем электроснабжения существуют

Есть ряд платформ, среди которых есть платные и их бесплатные аналоги. Основной функционал остается прежним, но купленные ПО предлагают ряд дополнительных инструментов. Расскажем о наиболее популярных.

Автокад

Еще недавно этот продукт занимал лидирующие позиции на рынке систем конструирования. Компания Autodesk разработала этот софт еще в 1982 году, он сразу приобрел популярность среди инженеров. Сокращение AutoCAD в переводе означает «системы автоматизированного проектирования». Она представляет собой двух- или трехмерную программу для моделирования. Ее активно используют инженеры различных отраслей. Автокад переведен на 18 языков. Русскоязычная версия полностью адаптирована под пользователей нашей страны – весь интерфейс и инструментарий понятен и доступен. И лишь инструкция не приспособлена для русских проектировщиков. За свою долгую жизнь компания разработала десятки версий, тысячи дополнений и вспомогательных приложений.

Если верить статистике, во всем мире около 6 000 000 потребителей используют возможности сервиса AutoCAD. Среди всех функций занимает особенное место система 3D-моделирования. Объемные фигуры можно воплотить в жизнь, благодаря возможностям трехмерной печати. У раскрученного бренда есть как рьяные сторонники, так и критики. Первые утверждают, что все минусы, приписываемые Автокаду, это лишь результат неполного изучения платформы и неумение использовать весь ее потенциал.

Вторые находят отрицательные стороны:

  • Первая является выводом из утверждения приверженников ПО: если большинство инженеров не может разобраться в возможностях софта, значит его функционал слишком трудно передан пользователю.
  • Часто отмечают, что графика AutoCADа не приспособлена для текстовых редакторов.
  • Система не признает некоторых чертежей, выполненных в других ПО.
  • Многочисленные надстройки к Автокаду часто имеют неудобный интерфейс.
  • С последним недостатком соглашаются как сторонники так и противники проги – ее цена завышена. И даже если предположить, что качество соотносимо со стоимостью, продукт от этого не становится доступнее.

Причины поиска других платформ:

За последние 5 – 7 лет позиции популярного программного обеспечения упали. Всё чаще инженеры ищут аналог зарубежных разработчиков. Это связано с введенной компанией политикой обязательного лицензирования и высокой ценой за продукт, согласно мнению пользователей. Крупные компании заинтересованы в поиске наиболее выгодных ПО для работы.

Основными критериями поиска являются:

  • широкие возможности для проектирования электронных систем, схожий набор функций;
  • удобный и простой интерфейс, понятный как специалисту, так и неопытному пользователю;
  • упрощенная система лицензирования;
  • приемлемая цена и гибкая система корпоративных скидок;
  • совместимость с проектами, выполненными в других софтах;
  • возможность приобретения обновлений и дополнительных модулей, расширяющих классический базовый комплект функций.

QElectroTech

Это одна из бесплатных программ на русском языке для черчения различных электрических схем: однолинейных, структурных и гидравлических. Она проста в использовании, благодаря большой библиотеке с готовыми макетами. Хорошо подойдет для начинающих и студентов, для которых не столько нужен широкий инструментарий, сколько важен нетрудный процесс проектирования. Но из-за небольшого разнообразия функций, система не подойдет для серьезных, сложных проектов и для профессиональной работы.

Visio

Еще один продукт, конкурирующий с популярными симуляторами. Он максимально удобен в работе: создатели грамотно подошли к классификации элементов. Разделение по группам сделало детали доступными, они перетаскиваются на макет и складываются одна с другой, как в конструкторе. Но библиотека готовых схем скуднее, чем у большинства программ. Ощутимым недостатком также является возможный сбой форматирования при включении с другой версии или в другом формате.

NanoCAD

Отличный отечественный аналог Автокада. Имеет приличный функционал и ряд дополнительных модулей. Интерфейс остается прежним и легко узнаваемым. В отличие от зарубежного продукта, удобна работа со слоями – есть функция удаления одного среза с переносом данных на предыдущий. Это позволяет не множить вкладки и не захламлять чертеж. Но есть мнения, по которым эта разработка не оправдала ожидания: она долго грузится и часто работает рывками или медленно реагирует, работает нестабильно. К минусам относят также неполноценное редактирование геометрии, в частности, невозможность обрезки сплайнов и штриховок.

▶▷▶▷ в какой программе нарисовать однолинейную схему электроснабжения

▶▷▶▷ в какой программе нарисовать однолинейную схему электроснабжения
ИнтерфейсРусский/Английский
Тип лицензияFree
Кол-во просмотров257
Кол-во загрузок132 раз
Обновление:15-03-2019

в какой программе нарисовать однолинейную схему электроснабжения — Yahoo Search Results Yahoo Web Search Sign in Mail Go to Mail» data-nosubject=»[No Subject]» data-timestamp=’short’ Help Account Info Yahoo Home Settings Home News Mail Finance Tumblr Weather Sports Messenger Settings Want more to discover? Make Yahoo Your Home Page See breaking news more every time you open your browser Add it now No Thanks Yahoo Search query Web Images Video News Local Answers Shopping Recipes Sports Finance Dictionary More Anytime Past day Past week Past month Anytime Get beautiful photos on every new browser window Download Чертим однолинейную схему — обзор бесплатных программ moonbackru/page/risuem-odnolinejnuju-shemu Cached В чем нарисовать однолинейную электрическую схему Программ для черчения на компьютере (да, да электрические схемы не рисуют, а чертят!) много Но все они как правило сложны в освоении, если Программа для рисования схем: бесплатная, платная stroychikru/elektrika/programmy-dlya-risovaniya-shem Cached Результат можно сохранить в нескольких форматах: jpg, png, bmp, svg, импортировать данные (открыть в данной программе ) можно в форматах qet и xml, экспортировать — в формате qet Что такое однолинейная схема электроснабжения? sem-oktru/blog/raznoe/odnolinejnaya-sxema Cached Основное назначение однолинейной схемы – помощь в подключении установок, а также поиске неисправности в цепи Пример: А в какой программе можно нарисовать однолинейную схему ? Черчение электрических схем по ГОСТ в Visio — YouTube wwwyoutubecom/watch?v=w_lhC3i-3_0 Cached Как начертить электрическую схему по ГОСТ? черчения электросхем в программе Visio, нарисовать розетки Программа Для Однолинейных Схем Электроснабжения erogonphoenixweeblycom/blog/programma-dlya Cached Практика показывает, что самостоятельно нарисовать для того или иного объекта однолинейную электрическую схему весьма затруднительно, если вы не обладаете специальными навыками и Программы для черчения электрических схем квартир и домов samelectrikru/obzor-luchshix-programm-dlya Cached Однако Вы сами понимаете, что в платных версиях предоставлен более широкий набор возможностей и удобных дополнений, которые позволят начертить эл схему на компьютере Как сделать однолинейную схему электроснабжения своими руками agk-sportru/osveshhenie/kak-sdelat Cached В чем нарисовать однолинейную электрическую схему Программ для черчения на компьютере (да, да электрические схемы не рисуют, а чертят!) много Однолинейная схема электроснабжения в visio скачать бесплатно 1004kvru/fazaa/однолинейная Cached Для просмотра натуральную величину, откройте схему (чертеж) в новой вкладке Автор Тема: Подскажите в какой программе рисовать такие однолинейные схемы? (Прочитано 1823 раз) Программы для электриков: краткий обзор наиболее популярных electrikinfo/main/school/746-programmy-dlya-elektrikov Cached В данной программе очень удобно создавать схему любой сложности Программа имеет очень удобный интерфейс, поэтому на освоение в ней не нужно большого количества времени Как нарисовать электрическую схему на компьютере — обзор hami-millionru/stroitelstvo/kak-narisovat-elekt Cached В чем нарисовать однолинейную электрическую схему Программ для черчения на компьютере (да, да электрические схемы не рисуют, а чертят!) много Promotional Results For You Free Download | Mozilla Firefox ® Web Browser wwwmozillaorg Download Firefox — the faster, smarter, easier way to browse the web and all of Yahoo 1 2 3 4 5 Next 450 results Settings Help Suggestions Privacy (Updated) Terms (Updated) Advertise About ads About this page Powered by Bing™

  • Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа
  • труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Гимназия 3 г. Астрахань. Общие сведения о гимназии,
  • тура, пособия, утилиты, программы для AutoCAD. Гимназия 3 г. Астрахань. Общие сведения о гимназии, ступени обучения, дифференциация классов. Описание предметных циклов, традиции и праздники школы. Академия рынка труда и информационных технологий. Структура вуза, перечень специальностей, правила оформления дипломных проектов, программы профессиональной переподготовки. Портал Правительства Калининградской области. Регион, власть, общество, новости, экономика, гражданам, бизнесу. Схема электроснабжения и газоснабжения. \N \n DjFiesto\n 21 авг 2016 в 15:44\n \n \n\n. \NУ нас в городе данный тип воров не распространён.\n\n\n\n. Информационный сайт городской администрации Ульяновска. Новости, устав, мероприятия, правовые документы. Уважаемые жители города Ульяновска! Хозяйственные строения (строения или сооружения вспомогательного использования) в с/т «Береговой», участок 486», зона ООПТ «Винновская роща»…

правила оформления дипломных проектов

устав

  • bmp
  • а чертят!) много Но все они как правило сложны в освоении
  • svg

в какой программе нарисовать однолинейную схему электроснабжения — Поиск в Google Специальные ссылки Перейти к основному контенту Справка по использованию специальных возможностей Оставить отзыв о специальных возможностях Нажмите здесь , если переадресация не будет выполнена в течение нескольких секунд Войти Удалить Пожаловаться на неприемлемые подсказки Режимы поиска Все Картинки Видео Новости Карты Ещё Покупки Книги Авиабилеты Финансы Настройки Настройки поиска Языки (Languages) Включить Безопасный поиск Расширенный поиск Ваши данные в Поиске История Поиск в справке Инструменты Результатов: примерно 9 810 (0,40 сек) Looking for results in English? Change to English Оставить русский Изменить язык Результаты поиска Все результаты Чертим однолинейную схему — обзор бесплатных программ Сохраненная копия Похожие 5 мая 2014 г — Занимаясь ремонтом дома столкнулся с необходимостью нарисовать однолинейную схему электроснабжения Все можно было Видео 10:53 Как быстро начертить однолинейную эл схему! White Raven YouTube — 1 нояб 2015 г 8:35 Как начертить однолинейную схему щита Советы электрика YouTube — 8 апр 2016 г 12:34 Конструктор однолинейных схем Описание работы Денис Рыженков YouTube — 13 мар 2016 г Все результаты Программа для рисования схем: бесплатная, платная — stroychikru stroychikru/elektrika/programmy-dlya-risovaniya-shem Сохраненная копия Похожие Как нарисовать электрическую схему на компьютере — обзор программ Электрик; 14 Программа DipTrace — для рисования однолинейных схем и быть недостаточно, но для создания схемы электроснабжения дома или ‎ Бесплатные программы · ‎ Редактор · ‎ Программа DipTrace Программы для черчения электрических схем квартир и домов › База знаний › Софт для электриков Сохраненная копия Похожие Рейтинг: 4,2 — ‎12 голосов 28 апр 2015 г — Лучшие бесплатные и платные программы на русском языке для не только рисовать однолинейные схемы электроснабжения , но и Рисование электрических схем в программе Microsoft Word wwwsxemotehnikaru/programmi/risovanie-elektricheskich-schem-v-programme-m Сохраненная копия Похожие В этой статье я расскажу как с помощью широко известного текстового редактора Word можно быстро нарисовать электрическую принципиальную Программа для рисования схем электроснабжения — zwcad wwwzwsoftru/stati/programma-dlya-risovaniya-skhem-elektrosnabzheniya Сохраненная копия Как нарисовать однолинейную схему электроснабжения ,какими САПР- программами пользоваться для разработки,черчения и построения Однолинейная схема электроснабжения: рисование и создание 6wattru/elektrosnabzhenie/odnolinejnaya-skhema-elektrosnabzheniya Сохраненная копия Однолинейная схема электроснабжения – как нарисовать Программы для создания и черчения своими руками на русском языке для электриков Программа для электриков «Elproject» для разработки однолинейных Сохраненная копия 21 окт 2017 г — 17 сообщений — ‎3 автора Программа предназначена для разработки принципиальных однолинейных схем групповых щитов Я сам инженер-проектировщик и Обзор 20 лучших программ для черчения электрических схем › Главная › Основы электротехники Сохраненная копия Рейтинг: 4,8 — ‎4 голоса 25 февр 2018 г — Программы для рисования электрических схем – обзор 20 в которой можно создать как принципиальную схему, так и макет Формирование конструкторской документации ( однолинейной схемы , спецификации, отвечающей нормам Примеры однолинейной схемы электроснабжения Как сделать однолинейную схему электроснабжения своими › Электрика в квартире › Монтаж Сохраненная копия Похожие Особенности составления однолинейной схемы электроснабжения , как В частности, программа AutoCAD вам поможет создать проект офиса, Программа для черчения однолинейных схем — электротехнический форум forum220ru/viewtopicphp?f=46t=1891 Сохраненная копия Похожие 22 февр 2014 г — Ув форумчане, дайте совет Чем чертить однолинейные схемы ? Тяжелые проги типа автокада или компаса не подходят, нужно что Софт для составления схем электроустановок — форум электриков и wwwelectrikorg › › Проектирование › ПО по проектированию ЭУ Сохраненная копия Похожие 4 окт 2008 г — 15 сообщений — ‎8 авторов Скажите если знаете вот это: Программа для рисования однолинейных схем электроснабжения ! Ищу программу для черчения схем типа таких: И потом поробовать поменяться, если чего путное нарисуете Программа sPlan — создание схем электрических » скачать Сохраненная копия Программа sPlan — инструмент для создания схем » скачать бесплатно Картинки по запросу в какой программе нарисовать однолинейную схему электроснабжения Другие картинки по запросу «в какой программе нарисовать однолинейную схему электроснабжения» Жалоба отправлена Пожаловаться на картинки Благодарим за замечания Пожаловаться на другую картинку Пожаловаться на содержание картинки Отмена Пожаловаться Все результаты Рисуем (чертим) однолинейные схемы электроснабжения wwwvodavsegdaru/artphp?id=88 Сохраненная копия Похожие Однолинейные схемы электроснабжения частных домов однолинейные схемы , чертим однолинейные схемы , кто может нарисовать однолинейную Однолинейная схема: образец, как нарисовать, виды и этапы › Элементы электрики › Схемы Сохраненная копия Рейтинг: 4,8 — ‎54 голоса Как нарисовать однолинейную схему электроснабжения задействовав компьютер и хорошо зарекомендовавшую себя программу AutoCAD Программа для составления однолинейных схем beiperhypylhatenablogcom/entry/2017/06/03/081140 3 июн 2017 г — Как быстро нарисовать электрическую схему Программы для расчета сечения Примеры однолинейной схемы электроснабжения Срочно нарисовать однолинейную схему по электрике в г Москва remontyoudocom/st1244785/ Сохраненная копия Нужно нарисовать однолинейную схему электрики для торгового островка работы для электрика Выполнить однолинейную схему электроснабжения ▷ программа для создания однолинейных электрических схем didocrosbycom//programma-dlia-sozdaniia-odnolineinykh-elektricheskikh-skhem-s Сохраненная копия 27 дек 2018 г — программа для создания однолинейных электрических схем скачать Как нарисовать однолинейную схему электроснабжения ,какими Онлайн Электрик: Симулятор электрических схем Сохраненная копия Зеленый цвет элемента схемы указывает на положительное Алюнов, АН Онлайн Электрик: Интерактивные расчеты систем электроснабжения Однолинейная схема электроснабжения — что это, требования к Сохраненная копия Что такое однолинейная схема электроснабжения и как ее нарисовать ? Интерфейс программы для создания ОСЭ и прочих электрических схем Примеры однолинейных схем электроснабжения — Dwgru Сохраненная копия Похожие 19 апр 2005 г — Download: Примеры однолинейных схем электроснабжения Прочее Подскажите в какой программе рисовать такие однолинейные схемы eomcomua › Проектирование › Программы, САПР и пр Сохраненная копия Похожие 27 мая 2015 г — Подскажите в какой программе рисовать такие однолинейные схемы ? Какой программой можно чертить такие однолинейные схемы для однолинейную схему электроснабжения большого предприятия в Кто в чём чертит схемы Форум электриков и энергетиков — Вольтмастер wwwvolt-mru/forum/view/1481/?fpage=2 Похожие 28 февр 2015 г — Возможно, но у меня на работе коллега черти однолинейные Плюсом таких программ , как Автокад и Компас является то, что это Можно просто нарисовать любую электрическую схему , без привязки к зданию (помещению ) В комплект поставки «Компас Электроснабжения » все эти Однолинейная схема — Superjob Сохраненная копия 26 янв 2011 г — Вопрос о однолинейной схеме электроснабжения ВРУ 0,4 кВ в табличной форме Поставте программу , редактора схем, типа Компаса-электрик Можно и однолинейную схему нарисовать — с указанием всех Visio для черчения электрических схем Сохраненная копия Похожие 15 мая 2009 г — Выбор программы для создания электрических схем Программы для электриков | Советы электрика ceshkaru/category/elektro-programmy Сохраненная копия Похожие И поможет нам в этом конечно же программа для электриков которая так и по помещению с рулеткой и вымерять все размеры, рисовать схему и тд помещения, однолинейные схемы электроснабжения потребителей и тп Однолинейная схема электроснабжения — Проектируем электрику vgs-design-elblogspotcom/2013/08/blog-post_11html Сохраненная копия Похожие 11 авг 2013 г — Почему схема однолинейная? Однолинейная схема – это та же принципиальная схема, только выполненная в упрощенном виде: все Программа для проектирования электропроводки в доме › Электропроводка Сохраненная копия Рейтинг: 5 — ‎5 голосов 27 мая 2017 г — Даже в таком виде они позволяют нарисовать схему для монтажа причем полноценная однолинейная схема электропроводки не Что такое однолинейная схема электроснабжения? sem-oktru › Блог › Разное Сохраненная копия Как нарисовать однолинейную схему ? Исполнительная схема электроснабжения применяется с целью перерасчета существующей системы подачи А в какой программе можно нарисовать однолинейную схему ? Вот такую Однолинейная схема в AutoCAD Electrical — Autodesk Community Сохраненная копия 26 апр 2017 г — По данным схемы автоматически формируется спецификация: http:// acadedreamblogspotru/2017/05/blog-posthtml Программы для электриков: краткий обзор наиболее популярных electrikinfo//746-programmy-dlya-elektrikov-kratkiy-obzor-naibolee-populyarnyh Сохраненная копия Похожие Существует множество полезных программ для электриков, которые Редактор схем позволяет создать несколько видов схем, начиная от электросхему токарного станка, инженер – однолинейную схему электрической сети, Выполню однолинейную схему электроснабжения за 500 руб › Стиль жизни › Инжиниринг › Чертеж, схема Сохраненная копия Рейтинг: 5 — ‎25 голосов Разработка однолинейной схемы электроснабжения для объекта мощностью до 15 кВт Это может быть небольшой офис, квартира, коттедж, другой Однолинейная схема электроснабжения цеха предприятия Сохраненная копия 23 окт 2017 г — Принципы построения однолинейной схемы энергоснабжения цеха на схеме необходимо нарисовать одну линию с тремя косыми Разработанные, в основном за рубежом, подобные программы имеют Однолинейная схема электроснабжения — Форум электриков forum-electrikovru/viewtopicphp?t=703 Сохраненная копия Похожие 15 мар 2016 г — однолинейную схему электроснабжения на которой также надо Только вряд ли кто возьмется втемную рисовать , на догадках Однолинейная схема программа для рисования онлайн kmakffuajtjzzzcomua//odnolineynaya-shema-programma-dlya-risovaniya-onlaynht токарного станка, инженер – однолинейную схему электрической сети, однолинейные схемы электроснабжения потребителей и тп Windows Теперь можно начинать рисовать Программы для создания однолинейных схем Чертежи и схемы в Visio Сохраненная копия Похожие однолинейных , электроснабжения , освещения, схем компоновки, а также Построение чертежей и схем , в программе Visio, процесс предельно Как быстро начертить однолинейную эл схему!, Видео, Смотреть ▶ 10:53 1 нояб 2015 г — Добавлено пользователем White Raven Однолинейная схема электроснабжения дома УЗО схема подключения Простая программа для создание электрических схем Как Создание электротехнической схемы — Visio — Office Support Сохраненная копия Используйте Visio для создания электрических технологических схем , в том На вкладке файл нажмите кнопку создать , а затем найдите шаблоны для Анализ проблем в области автоматизированного проектирования Сохраненная копия 27 дек 2015 г — В этой статье описаны наиболее популярные программы , которые не только рисовать однолинейные схемы электроснабжения , но и Ответы MailRu: Как сделать однолинейную схему электроснабжения › Наука, Техника, Языки › Техника Сохраненная копия В «Свердловэнерго» потребовали предоставить однолинейную схему электроснабжения гаража Якобы обследование будут делать они, однолинейные схемы-(чертежи) — Страница 3 — Форум по электрике и wwwelectric-houseru › Форум › Техническая зона › Схемы по электрике Сохраненная копия Похожие 7 окт 2011 г — Доброго времени сутокНарод кто знает сколько стоит нарисовать однолинейную схему ЕЩ(квартирного)в моём случае один щит на 8 Проектирование электроустановок ПРОЕКТЭЛЕКТРОРУ Сохраненная копия Программа на сайте — это адаптированная для работы в Интернет версия Windows приложения Проект электроснабжения цеха большого завода, электрооборудование Теперь можно начинать рисовать однолинейные схемы Мечта электрика: AutoCAD Electrical: Однолинейная схема acadedreamblogspotcom/2013/01/blog-post_23html Сохраненная копия Похожие 23 янв 2013 г — Построить однолинейную схему управления двигателем · По данным схемы создать чертеж компоновки · Сформировать отчеты Программа для создания однолинейной схемы электроснабжения condiceldeskde35c0pl//programma-dlya-sozdaniya-odnolineynoy-shemi-elektrosnab Программа для создания однолинейной схемы электроснабжения без труда изобразит Теперь можно начинать рисовать однолинейные схемы Самая популярная программа для проектирования электрики — Proektby proektby//samaya_populyarnaya_programma_dlya_proektirovaniya_elektriki-t209 Сохраненная копия 6 сент 2007 г — 31 сообщение — ‎8 авторов Самая популярная программа для проектирования электрики Я черчу все однолинейные схемы в visio 2007 ,оздал сой набор элементов в висио хорошо рисовать схемы подключений, технологические схемы, Главные схемы электрических соединений подстанций forcacomua/info/spravka/glavnye-shemy-elektricheskih-soedinenii-podstanciihtml Сохраненная копия Похожие Однолинейные схемы составляют для всей электроустановки, те участки, Для электроснабжения потребителей третьей категории применяют схемы Список программ для создания электрических схем prorabkincom/electro/programmy-dlya-chercheniya-elektricheskih-shem Сохраненная копия 5 Программа для электрических схем : 4 лучших помощника рисованием электрических схем и, хоть это и возможно нарисовать Для проведения работ по электроснабжению различных объектов применяют однолинейные Типовые однолинейные схемы ВРУ Вводно-распределительные wwwdiselecru › › Вводно-распределительные устройства (ВРУ) Сохраненная копия Похожие обозначение наименование FU1-FU3 Предохранители ПН2-250 FU4-FU9 Предохранители ПН2-60 FU10-FU18 Предохранители ПН2-100 PI1 есть у кого нибудь трафареты для visio — фото- Форум Mastergrad wwwmastergradcom › › Электрика › есть у кого нибудь трафареты для visio Сохраненная копия Похожие 25 авг 2009 г — 20 сообщений — ‎8 авторов 2kai82 Для таких схем достаточно один раз нарисовать , а потом копировать конкретно хотелось бы получить то что содержит программа Gost трафареты для черчения однолинейных схем в visio примерно Вместе с в какой программе нарисовать однолинейную схему электроснабжения часто ищут как начертить однолинейную схему электроснабжения конструктор однолинейных схем программа для рисования электрических схем по госту однолинейные схемы электроснабжения в visio днд конструктор однолинейных схем скачать бесплатно в какой программе рисовать схемы программа для рисования электрических схем квартиры hlsys lume Навигация по страницам 1 2 Следующая Ссылки в нижнем колонтитуле Россия — Подробнее… Справка Отправить отзыв Конфиденциальность Условия Аккаунт Поиск Карты YouTube Play Новости Почта Контакты Диск Календарь Google+ Переводчик Фото Ещё Покупки Документы Blogger Hangouts Google Keep Jamboard Подборки Другие сервисы Google

Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Гимназия 3 г. Астрахань. Общие сведения о гимназии, ступени обучения, дифференциация классов. Описание предметных циклов, традиции и праздники школы. Академия рынка труда и информационных технологий. Структура вуза, перечень специальностей, правила оформления дипломных проектов, программы профессиональной переподготовки. Портал Правительства Калининградской области. Регион, власть, общество, новости, экономика, гражданам, бизнесу. Схема электроснабжения и газоснабжения. \N \n DjFiesto\n 21 авг 2016 в 15:44\n \n \n\n. \NУ нас в городе данный тип воров не распространён.\n\n\n\n. Информационный сайт городской администрации Ульяновска. Новости, устав, мероприятия, правовые документы. Уважаемые жители города Ульяновска! Хозяйственные строения (строения или сооружения вспомогательного использования) в с/т «Береговой», участок 486», зона ООПТ «Винновская роща»…

▶▷▶▷ программа составления однолинейных электрических схем

▶▷▶▷ программа составления однолинейных электрических схем
ИнтерфейсРусский/Английский
Тип лицензияFree
Кол-во просмотров257
Кол-во загрузок132 раз
Обновление:05-04-2019

программа составления однолинейных электрических схем — Программа Составления Однолинейных Электрических Схем bookcurrentweeblycomblogprogramma Cached Конструктор однолинейных электрических схем Однолинейных Схем Составления схем Программа КОМПАС-3d Такие комплекты для черчения электрических схем будет полезен Бесплатная программа для рисования электрических схем wwwyoutubecom watch?vMpgGSTrJXJc Cached Бесплатная программа для рисования электрических схем SoftFlyru Моделирование электронных схем в Multisim Программа Составления Однолинейных Электрических Схем — Image Results More Программа Составления Однолинейных Электрических Схем images Программы для черчения электрических схем квартир и домов samelectrikruobzor-luchshix-programm-dlya Cached Как ни странно, но наиболее популярной и что не менее важно бесплатной программой для черчения однолинейных электрических схем на компьютере является векторный графический редактор Visio Программа для черчения электрических схем: какой выбрать etotdomcomremontprogramma-dlya-elektricheskix-sxem Cached Программа для электрических схем это инструмент, используемый инженерами, для создания электронных схем с целью расчета и тестирования изделий на этапах проектирования, производства, а также эксплуатации Программы для черчения электрических схем cxemnetsoftwaresoft_sketchphp Cached Программа полностью на русском языке Редактор электрических схем рассчитан на Программа Для Составления Однолинейных Схем — booksinstitute booksinstituteweeblycomblogprogramma-dlya Cached Программа для электрических схем плюсы и минусы Visio, QElectroTech Для Составления Программа Для Составления Однолинейных Схем — spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс, предназначенный Программа создана только для составления однолинейных Программа Составления Однолинейных Электрических Схем lettercove235weeblycomblogprogramma Cached Программа Составления Однолинейных Электрических Схем виды электрических схем , в том Программа Составления Однолинейных Электрических Схем chatessentialweeblycomblogprogramma Cached Форумы сайта электрик gt программа Можно найти программу для рисования электрических схем Программа Составления Однолинейных Электрических Схем — softspice softspiceweeblycomblogprogramma-sostavleniya Cached Добрый день, GOST Electro for Visio брал для составления схем по схемотехнике, Давно искал аналогичную программу, пытался и автокад и нам работу по разработке однолинейных электрических схем Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox — the faster, smarter, easier way to browse the web and all of 1 2 3 4 5 Next 2,680

  • Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа
  • труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных
  • тура, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных электрических схем электрооборудования здания Арбитражного суда Свердловской области. Сведения о связи с позицией плана-графика. Знание ПУЭ, ПТЭЭП, современных схем электро снабжения зданий, диспетчеризации, КИПа. опыт проектирования внутреннего электроснабжения. …электро оборудования, организация ППР и текущего ремонта, проектирование внутреннего электроснабжения, составление схем электроснабжения, однолинейных электрических схем,… Промо-программы. Создание принципиальной схемы распределительной и питающей сетей; Составление силовых однолинейных схем; Создание однолинейных расчетных схем; Подведение итогов 13.00 ЗАВЕРШЕНИЕ РАБОТЫ КОНФЕРЕНЦИИ. Деловая программа научно технической конференции современные технологии строительства и ремонта трубопроводов. ФГОС и программы общего образования. Русский язык: избранные ресурсы. К составлению аналитических справок подключится также Федеральный институт педагогических измерений. …Первушин А. …. 187 Метод автоматической разметки предложения для этапа синтаксической сегментации, Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка, Кочеткова Н.А. … 199 Параллельный алгоритм составления…

пособия

Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка

  • пытался и автокад и нам работу по разработке однолинейных электрических схем Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox — the faster
  • QElectroTech Для Составления Программа Для Составления Однолинейных Схем — spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс
  • QElectroTech Для Составления Программа Для Составления Однолинейных Схем — spisoklicious spisokliciousweeblycomblogprogramma-dlya Cached ДНД Конструктор Однолинейных Схем это программный комплекс

программа составления однолинейных электрических схем Все результаты Программа для электриков Elproject для разработки однолинейных окт г сообщений автора Программа Elproject предназначена для разработки принципиальных схем групповых электрических щитов промышленных и Обзор лучших программ для черчения электрических схем Рейтинг , голоса февр г Программы для рисования электрических схем обзор популярных Формирование конструкторской документации однолинейной схемы , QElectroTech программа для составления , просмотра и печати Microsoft Visio Dip Trace схема XCircuit Чертим однолинейную схему обзор бесплатных программ Похожие мая г Пример однолинейной электрической схемы Программа позволяет корректно подобрать серию корпуса и его размер, исходя из Видео Автоматическая прорисовка однолинейной схемы Autelec ! YouTube сент г Как быстро начертить однолинейную эл схему! White Raven YouTube нояб г Конструктор однолинейных схем Описание работы Денис Рыженков YouTube мар г Все результаты Программа для рисования схем бесплатная, платная stroychikru Облегчить и ускорить черчение схем может программа для рисования схем Редактор электрических схем QElectroTech; Графический Компас Электрик; Программа DipTrace для рисования однолинейных схем и Бесплатные программы Редактор Программа DipTrace Программы для черчения электрических схем квартир и домов База знаний Софт для электриков Похожие Рейтинг , голосов апр г Обзор лучших программ для составления электрических схем же бесплатных ПО для составления однолинейных электросхем на компьютере Еще одна популярная программа для черчения электросхем и Программа для рисования схем электроснабжения ZwCAD Как нарисовать однолинейную схему электроснабжения,какими когда в программе для разработки электрических схем можно нажать пару кнопок, Программа для черчения однолинейных схем электротехнический форум forumruviewtopicphp?ft Похожие февр г Программа для черчения однолинейных схем нашел только обсуждение софта для выполнения электрических принципиальных схем С Hager работал тоже удобная штука для составления однолинеек, жаль Программа для Однолинейных Электрических Схем ДНД КОС ДНД Конструктор Однолинейных Схем удобный программный инструмент для автоматизированного составления однолинейных электрических схем Софт для составления схем электроустановок форум электриков и wwwelectrikorg Проектирование ПО по проектированию ЭУ Похожие окт г сообщений авторов Там же видеоуроки по черчению электрических схем Ищу программу для черчения схем типа таких чертит однолинейные схемы в DXF открываются в AutoCAD, делает спецификацию с партномерами Программа sPlan создание схем электрических скачать Программа sPlan инструмент для создания схем скачать бесплатно Программы для электриков краткий обзор наиболее популярных electrikinfoprogrammydlyaelektrikovkratkiyobzornaiboleepopulyarnyh Похожие Рассмотрим популярную программу для создания электрических схем sPlan токарного станка, инженер однолинейную схему электрической сети, Рисование электрических схем в программе Microsoft Word wwwsxemotehnikaruprogrammirisovanieelektricheskichschemvprogrammem Похожие Для рисования электрических схем существуют большое множество программ В этой статье я расскажу как с помощью широко известного текстового Однолинейная схема электроснабжения назначение, виды Коммуникации Электрика и освещение Рейтинг , голосов Однолинейная схема электроснабжения что это такое и её виды, DipTrace программа используется для составления электрических схем и Однолинейная схема электроснабжения рисование и создание wattruelektrosnabzhenieodnolinejnayaskhemaelektrosnabzheniya Однолинейная схема электроснабжения как нарисовать Расчетная А этот вид схемы составляется при строительстве нового объекта Эльф Данная программа отличный помощник для проектирования схем На сегодняшний день существует масса программ для рисования электрических схем QElectroTech программа для рисования электрических схем QElectroTech бесплатная программа для проектирования рисования электрических схем Позволяет создавать схемы , используя большой набор Картинки по запросу программа составления однолинейных электрических схем Другие картинки по запросу программа составления однолинейных электрических схем Жалоба отправлена Пожаловаться на картинки Благодарим за замечания Пожаловаться на другую картинку Пожаловаться на содержание картинки Отмена Пожаловаться Все результаты Список программ для создания электрических схем prorabkincomelectroprogrammydlyachercheniyaelektricheskihshem Перейти к разделу Примеры бесплатных программ для выполнения однолинейной Программа схема доступна для копирования с программа для создания однолинейных электрических схем didocrosbycomprogrammadliasozdaniiaodnolineinykhelektricheskikhskhems дек г программа для создания однолинейных электрических схем скачать бесплатно Yahoo Search Results Yahoo Web Search Sign in Mail программа для рисования электрических схем SoftFlyru wwwsoftflyrugrafikarisovanieqelectrotech Похожие В данной программе имеется множество различных элементов для начертания электрических схем , таких как элементы логических схем , Язык интерфейса Русский Программа для составления однолинейных схем beiperhypylhatenablogcomentry июн г Программа для составления однолинейных схем электроснабжения Программы для рисования электрических схем проводки Rusplan отличная программа для рисования схем рекомендуем radiobookaru Полезные программы для радиолюбителей Похожие Rusplan отличная программа для рисования схем рекомендуем Можно легко редактировать элементы библиотеки и создавать свои Скачать PDF программа для составления однолинейных электрических схем электросхем на компьютере Полностью бесплатная программа для черчения электрических схем на компьютере Составление однолинейных схем Программы для черчения электрических схем Сайт Паяльник cxemnet Программы Похожие Простая в работе программа для рисования наглядных электрических схем , заточенная под Arduinoпроекты Программа свободно распространяется и Программы для создания схем Форум Mastergrad wwwmastergradcom Электрика Программы для создания схем янв г сообщения авторов Какие есть программы для рисования электрических схем ? если могу еще поделитиься файлом однолинейной схемы в Экселе Ищу программу для создания визуальной схемы квартирного эл щита Программы Для Чертежей Однолинейных Электрических Схем мар г Данная программа для создания схем , хорошо работает с векторной графикой программам для подготовки однолинейных электрических схем Обзор лучших программ для составления электрических схем лучших программ для построения электрических схем Программы для радиолюбителя Рейтинг голосов Это программа для рисования схем в Windows, доступная для бесплатной однолинейных диаграмм;; создания блок схем ;; разработки технических Программа для черчения электрических схем для чего нужна Перейти к разделу Примеры платных программ для выполнения однолинейной Создание чертежей электрических схем sPlan Здесь перед ВИДЫ ЭЛЕКТРИЧЕСКИХ СХЕМ ПРИМЕНЯЕМЫХ В СТК conssystemsruvidylektricheskikhskhemprimenyaemykhvraspredelitelnykhsety Похожие Автоматизированное составление однолинейных схем , подсчет нагрузок, подбор Программа включает в себя достаточно обширную базу возможных Splan скачать бесплатно Splan Sibnet Софт Рейтинг , голоса Для рисования электрических схем программа удобна Опубликовал статьи и журналах ВАК с ее помощью Просто вырезал изображения с экрана из Однолинейные схемы электроснабжения Проектирование и февр г Составление однолинейных электрических схем силового оборудования, освещения в программе Visio и AutoCAD разработка схем Программы для рисования электрических схем проводки Электрофорум electroforumsuindexphp?topic Похожие февр г Возможно я что то не допонял в электрических однолинейных схем с я Черчение электрических схем в программе sPlan ОтветыMailRu посоветуйте программу для создания однолинейных Компьютеры, Связь Прочее компьютерное апр г скачивала sPlan виснет, QElectroTech не рабочая Программа составления однолинейных схем Автор Олег Андрушко lsrgnlconsultationprogrammasostavleniyaodnolineynihshemhtml Программа составления однолинейных схем различных параметров электрических систем, изображать электрические схемы , выбирать различное Программа схема для комплектации распределительных Программа схема разработана для выбора оборудования модульных спецификации и отрисовки однолинейной электрической схемы щита Программа для проектирования электропроводки в доме Электропроводка Рейтинг голосов мая г Программа для расчета электропроводки в доме бесплатные и коммерческие решения Графический редактор для составления схем проводки и рисования причем полноценная однолинейная схема электропроводки не Бесплатная программа для рисования электрических схем promise Программы для проектирования электрики и монтажных irinvestruproductspromisephp Похожие Программа для проектирования электрики promise представляет собой электрических схем , таблиц соединений, компоновку монтажных схем и полностью исключить ошибки при составлении перечней элементов к Наряду с расчетами, составляются однолинейные схемы щитового оборудования Проектирование электрических схем; расчет электрических wwwsapralfaruindexphp?fuseactionalfa_se Похожие Альфа Составление однолинейных схем , подсчет нагрузок, подбор оборудования, выполнить проект, начиная с однолинейной электрической схемы Программа включает в себя достаточно обширную базу возможных Нарисовать принципаильную схему в ворде просто! RUQRZCOM сент г Рисуем принципиальную схему в редакторе MS Word специальную программу рисования электрических схем ;; простота рисования Правила чтения электрических схем и чертежей Школа для electricalschoolinfomainpravilachtenijajelektricheskikhskhemhtml Похожие Правила чтения электрических схем и чертежей Основными техническими документами для электромонтера и электромонтажника являются чертежи и Однолинейная схема щита программа для отрисовки по ГОСТ ddecadruavtomaticheskoeproektirovanieprintsipialnykhskhemelektricheskikhsch Похожие янв г Рассмотрим алгоритм создания однолинейных принципиальных схем электрических щитов в программе DDECAD Visio для черчения электрических схем Похожие мая г Выбор программы для создания электрических схем электрическую схему , и какую программу использовать для черчения схем ? Автоматическое составление спецификация, для меня так же не является nanoCAD Электро САПР и графика автор К Мокин После проведения расчета программа автоматически равномерно Расчет электрических нагрузок в nanoCAD Электро осуществляется по трем Рис Однолинейная схема электрической сети Рис Результаты Добро пожаловать в финальную версию QElectroTech! QElectroTech это хорошая чертежная программа профессионального качества для которые охватывают наиболее часто используемые в электрических , Эти элементы могут быть выбраны, перетянуты мышью в редактор схем и Однолинейный Однолинейное представление проводников строго DOC программа расчета однолинейных схем низкого и Программы РЗА окт г DOC это программа предназначена для создания и расчета Создание однолинейных электрических схем на низкое и среднее Программное обеспечение LEGRAND wwwlegrandrusupportlibrarysoftware Похожие Программа XL Pro упрощает проектирование низковольтных комплектных перечня, необходимое для сборки шкафа;; с помощью однолинейной схемы сектора, составлением проектов электрической части помещения Как сделать однолинейную схему электроснабжения своими Электрика в квартире Монтаж Похожие Особенности составления однолинейной схемы электроснабжения, как составить ее своими Однолинейная схема электроснабжения своими руками В частности, программа AutoCAD вам поможет создать проект офиса, торгового Соединение электрических проводов в распределительной коробке Отзывы покупателей Чертежи и схемы в Visio черчения электрических схем Нормальная схема ЭС РУ схемы главных цепей Прекрасный комплект для создания чертежей и схем в Visio! ps Не нашел обозначение Реле напряжения для однолинейной схемы Данная программа Библиотека Visio Электроавтоматика ПРО очень облегчает программа для моделирования электронных схем с проверкой galerielereverberecomprogrammadliamodelirovaniiaelektronnykhskhemspro мар г программа для моделирования электронных схем с проверкой Spicy schematics Программа для черчения электрических схем какой выбрать Программа Для Составления Однолинейных Схем booksinstitute COLAN KVM ATEN Форум Электрика Однолинейная схема распред wwwcolanruforumnewviewphp?idthreadfromstep Похожие сент г Просят схему РАСПРЕДЕЛИТЕЛЬНОЙ СЕТИ, а не щита Есть ГОСТы ЕСКД по оформлению принципиальных электрических схем , Вместе с программа составления однолинейных электрических схем часто ищут программа для рисования электрических схем квартиры программа для рисования электрических схем по госту программа для создания электрических схем и проверки конструктор однолинейных схем днд конструктор однолинейных схем скачать бесплатно составление электрических схем в какой программе рисовать схемы программа для чтения электрических схем Документы Blogger Hangouts Keep Jamboard Подборки Другие сервисы

Информация о программах Академии САПР и ГИС по обучению и повышению квалификации специалистов. Биржа труда проектировщиков. Каталог организаций и предприятий. Чертежи, нормативная документация, литература, пособия, утилиты, программы для AutoCAD. Оказание услуг по сверке и составлению однолинейных электрических схем электрооборудования здания Арбитражного суда Свердловской области. Сведения о связи с позицией плана-графика. Знание ПУЭ, ПТЭЭП, современных схем электро снабжения зданий, диспетчеризации, КИПа. опыт проектирования внутреннего электроснабжения. …электро оборудования, организация ППР и текущего ремонта, проектирование внутреннего электроснабжения, составление схем электроснабжения, однолинейных электрических схем,… Промо-программы. Создание принципиальной схемы распределительной и питающей сетей; Составление силовых однолинейных схем; Создание однолинейных расчетных схем; Подведение итогов 13.00 ЗАВЕРШЕНИЕ РАБОТЫ КОНФЕРЕНЦИИ. Деловая программа научно технической конференции современные технологии строительства и ремонта трубопроводов. ФГОС и программы общего образования. Русский язык: избранные ресурсы. К составлению аналитических справок подключится также Федеральный институт педагогических измерений. …Первушин А. …. 187 Метод автоматической разметки предложения для этапа синтаксической сегментации, Манушкин Е.С. … 191 Метод формирования модели глагольного управления для русского языка, Кочеткова Н.А. … 199 Параллельный алгоритм составления…

Как нарисовать схему онлайн? | ТЕХНО-СТАРЕЦ

Так как же нарисовать схему онлайн? Такой вопрос ставят себе тысячи людей, деятельность которых так или иначе связана с электротехникой, радиоэлектроникой и микроэлектроникой. Естественно для этого существуют специальные программы для рисования схем.

Начнем с того, что термин электрическая (принципиальная) схема используется в электронике радиолюбителями. Эта статья будет полезна студентам, инженерам и любителям.

Но что делать когда нет ресурсов и времени? На помощь приходят разнообразные онлайн сервисы. Оказывается нарисовать схему онлайн просто. Такие сервисы для рисования схем, так называемые редакторы схем, созданы специально для «упрощения жизни» разработчика и конечно различаются как удобством работы при создании схемы, так и функциональностью. Такие же функции рисования схем существуют во многих системах автоматического проектирования электронных схем.

Как разобраться в таком многообразии и выбрать сервис соответствующий вашим требованиям? Что делать когда вы сидите за чужим компьютером и на нем нет тех необходимых САПР программ? Главное иметь подключение к интернету.

Так вот, в интернете есть достаточно сервисов для рисования тех самых схем и даже симуляция работы схем. Действительно хороших, имеющих полный список радиоэлементов всего три, 123D CircuitsSchemeIt и CircuitLab. Сразу сообщу, что в них нет русского языка, только английский, возможно вам поможет Переводчик Google.

123D Circuits — проект компании Autodesk Inc, та которая сделала всем известный AutoCAD. В 123D Circuits тесно интегрирован Arduino (Ардуино — это небольшая плата с собственным процессором и памятью). Зарегистрировавшись вы получаете полноценный САПР редактор в который входят такие инструменты как:

  • онлайн симулятор проекта (Project Simulation)

  • онлайн редактор принципиальной схемы (Electronics Lab Hub)

  • онлайн редактор монтажной платы (PCB Design Hub)

  • еще интересной особенностью этого проекта в том, что симуляция схем включает в себя редактор кода прошивки c отладчиком (Code Editor)

Так же в 123D Circuits присутствует целая база (Libraries) радиоэлементов и их УГО. Все действия и результаты работы в данном онлайн редакторе сохраняются в вашем аккаунте на облаке, есть и экспорт в программу Gerber. В целом компания представила неплохой продукт пользователям.

SchemeIt — бесплатный инструмент для рисования схем. Очень большой список возможностей этого сервиса, начиная с простого рисования и заканчивая экспортом схемы в .png и .pdf, расшариванием в социалки и прямой печати. Имея аккаунт в SchemeIt можно сохранять недорисованную схему и закончить её в любое время.

Сам редактор выглядит таким образом:

Итог таков, довольно хороший инструмент для того чтобы быстро нарисовать схему и сохранить ее в графический формат, но не хватает нескольких УГО радиоэлементов.

CircuitLab — сборка и тестирование схем прямо в браузере. Этот сервис больше нацелен на тестирование собранной схемы, т.к. элементов там явно не хватает, однако в тех что есть — можно указать различные параметры, такие как напряжение и ток, сопротивление и емкость и др. для точности при тестировании. Конечно и здесь есть экспорт в графические форматы, а также сохранение схемы если есть аккаунт в CircuitLab.

«Лаборатория» выглядит так:

Подытожив скажу, многого что есть в обычных САПР программах в этом сервисе нету, хотя в принципе показать график зависимости он сможет, но все зависит от конкретной схемы. УГО элементов хватает, однако в SchemeIt их больше.

Вот мы и попробовали нарисовать схему онлайн:

— рассмотрели три основных сервиса для рисования схем онлайн, все остальные прогугленные мной сервисы просто используют их базу и API.

Если вы нашли что-то подобное в сети, прошу сообщить нам — статья будет дописана с указанием на ваш ник. Ждем комментариев и до встречи!

Программа для комплектации электрощитов «1-2-3 schema» Hager

Представительство компании Hager в лице компании ООО Электроконтроль предоставляет продукцию торговых марок Hager (Хагер), Berker (Беркер), Tehalit (Техалит), Polo (Поло) в ассортименте: модульные автоматические выключатели, корпусные автоматические выключатели, дифференциальные автоматические выключатели, диф.реле, рубильники, перекидные рубильники, выключатели нагрузки, устройства защитного отключения, реле времени, импульсное реле, суточное реле, сумеречное реле, контакторы, бесшумные контакторы, магнитные пускатели, индикаторы, измерительные приборы, вольтметры, амперметры, разрядники, кнопки, диммеры, датчики движения, проходные клеммы, наборные клеммы, монтажные клеммы, клеммники, вводно-распределительные блоки, фазные шины, кабельные разветвители, промышленные автоматические выключатели, таймеры, минищитки, настенные щитки, напольные щиты, секционные щиты, распределительные щитки, квартирные щитки, щитки электрические, щитки модульные, щиты с монтажной панелью, щиты учетно распределительные, щиты этажные, шкафы монтажные, шкафы распределения электроэнергии, влагозащитные щитки, щитки серий: Volta, Golf, Vector, Orion, Univers, кабельные каналы, перфорированные кабельные каналы, электромонтажные колоны, короба, гибкий офис, напольные кабельные каналы, рулонный канал, универсальные кабельные каналы, кабельные каналы tehalit серий: DA200, BRP, LFR, LFF, BA7A, LFR, DAP, SL, розетки, выключатели, электротехническая продукция серий Polo: Regina, Fiorena, Optima, Hermetica, 5655, Systo, термостаты, розетки для подзарятки USB, розетки VGA, HDMI, S-video, радиосистемы («Радиошин»), системы KNX, светорегуляторы и многое другое для инженерии в отрасли электромонтажа.

Всё предоставляемое оборудование, компания Электроконтроль поддерживает наличие на складе широкого ассортимента продукции и осуществляет доставку в города на территории Украины, такие как: Автономная республика Крым, Винница, Волынь, Днепропетровск, Донецк, Житомир, Закарпатье, Запорожье, Ивано-Франковск, Киев, Кировоград, Луганск, Львов, Николаев, Одесса, Полтава, Ровно, Суммы, Тернополь, Харьков, Херсон, Хмельницк, Черкассы, Чернигов, Севастополь, Кривой Рог и др. города Украины.

Сборка электрощита — программа 123 schema

Сборка электрощита распределительного  требует четкой последовательности, аккуратности и соблюдения требований и расчетов. Установить его в доме или квартире возможно собственными силами. Для этого нужно иметь базовые знания в электрике и желание более глубокого изучения всех особенностей электромонтажа.

Элементы распределительного щита

Распределительный щиток для квартиры или дома состоит из следующих основных элементов:

В каждом конкретном случае следует применять подобранные с учетом требований и расчетов компоненты. Любые дополнительные элементы повлекут к удорожанию сборки. Поэтому избегайте излишне перегруженных и необоснованных схем. В качестве дополнения, ознакомитесь с методикой подбора автоматов и УЗО.

Рекомендации по сборке электрощита

Выбрав необходимый по конструкции распределительный щит, можно переходить этапу проектирования и подбора соответствующей автоматики. При этом следует учесть и в дальнейшем придерживаться следующих рекомендаций:

  • Щит должен заполняться в соответствии с проектной документации. Допустим, положено десять автоматов, счетчик и восемь УЗО. В таком случае характеристики приобретаемого электрощита должны позволять уместить данное количество блоков. Небольшой резерв приветствуется.
  • В дальнейшем ориентировании по схеме поможет маркировка групп элементов бирками.
  • Придерживайтесь цветового единства жил провода. Для фазных проводников предпочтительными цветами являются черный, коричневый и серый.  Проводник заземления обычно имеет желто-зеленый цвет. Ноль (нейтраль) имеет синий или голубой цвет.
  • На каждую из клемм клеммной колодки подключайте по одному проводу. Монтаж нескольких жил в одно гнездо ухудшит фиксацию и со временем контакт может пропасть.
  • Для удобства подключения автоматики можно воспользоваться специальными шинами (гребенками).

Схема распределительного щита

Существует множество конфигураций схем электрощита. Различаются они по месту применения (для дома или квартиры), наличию заземляющего контура (заземление, зануление или их отсутствие), количеству фаз (однофазная схема 220 вольт или трехфазная 380 вольт) и другим параметрам. Углубляться в данный вопрос не будем. Рассмотрим лишь простую однофазную схему с заземлением и выделим основные особенности сборки.

Ниже представлена схема с указанием основных компонентов распределительного щита. 

  1. Корпус щита.
  2. Шина нулевых рабочих проводников.
  3. Шина нулевых защитных проводников (заземление или зануление).
  4. Устройство защитного отключения (УЗО).
  5. Автоматический выключатель.
  6. Счетчик электроэнергии.
  7. Линии групповых цепей.

Разработанная с учетом конкретного места назначения схема упростит ориентирование в разветвленной сети электропроводки, упорядочит потребителей энергии (бытовые электроприборы) и покажет назначение каждого задействованного элемента автоматики в электрощите.

Едиными правилами для любых схем распределительного щита являются:

  • Наличие вводного автомата перед счетчиком. С его помощью можно будет отключить все фазы питающего напряжения для обеспечения безопасного проведения работ по замене счетчика.
  • На электроплиты, духовые шкафы, кондиционеры и иную бытовую технику, обладающую большой мощностью целесообразно устанавливать отдельные автоматы в связке с УЗО. Либо скомпоновать данных потребителей с учетом их суммарной потребляемой мощности.
  • Для помещений с большой влажностью нужно устанавливать дополнительное УЗО или дифференциальные автоматы.
  • При компоновке электрощита необходимо соблюдать согласование характеристик установленных последовательно аппаратов защиты таким образом, чтобы в случае аварии отключалась только та линия питания или часть схемы, где возникла неполадка (принцип селективности).

Видео по сборке распределительного щита в программе 123 схема

В данном ролике рассмотрен типовой внутриквартирный электрический щит с выделенной мощностью 10 кВт. На его примере спроектирован компактный щит в программе 123 schema. Научившись работать в данной несложной программе в дальнейшем можно собрать электрощит практически любой конфигурации.

Программа 123 schema, скачать

Программа 123 схема позволяет подобрать конструкцию электрощита в соответствии требованиями, укомплектовать его защитной автоматикой, задать иерархию подключения модульных аппаратов и в автоматическом режиме сформировать однолинейную схему щита.

В комплекте с программой 123 Schema идет Semiolog. Данный инструмент позволяет создавать в автоматическом режиме красивые и аккуратные этикетки для маркировки групп потребителей в электрощитах.

Программа для создания электрических схем

— Простое создание электрической схемы

> Edraw Knowledge> Программа для электрических схем — Простое создание электрической схемы

Используйте встроенные символы электрических чертежей, чтобы создавать электрические схемы профессионального вида за считанные минуты. Edraw Max — это самый простой в использовании производитель электрических схем на рынке сегодня.

Программное обеспечение для электрических схем

Вы можете использовать встроенные электрические символы для создания хорошо составленных электрических схем за считанные минуты.Таким образом, стало довольно легко создавать схемы, электрические схемы, принципиальные схемы и другие электрические схемы. Выбирайте из переключателей, реле, трактов передачи, полупроводников, источников питания, батарей, компонентов интегральных схем и т. Д.

EdrawMax

Программное обеспечение для создания диаграмм All-in-One

Создавайте более 280 типов диаграмм без особых усилий

Легко приступайте к построению диаграмм с помощью различных шаблонов и символов

  • Превосходная совместимость файлов: Импорт и экспорт чертежей в файлы различных форматов, например Visio
  • Поддерживается кроссплатформенность (Windows, Mac, Linux, Интернет)

Обозначения на электрических схемах

Используйте символы электрических схем, чтобы без труда создавать электрические схемы.

Основные электрические символы

Такие символы, как земля, шасси, аккумулятор и резистор, могут максимально охватить потребности в построении электрической схемы.

Путь передачи

Что включает в себя группу предварительно нарисованных электрических символов для создания электрических схем в три раза быстрее, чем рисование от руки. Они расположены в библиотеках рядом с холстом для удобного поиска и использования.

Переключатели и реле

Большинство форм переключателей и реле имеют быструю плавающую кнопку для удобного редактирования. Наведите указатель мыши на символ, и в правом верхнем углу появится плавающая кнопка.

Полупроводники и электронные трубки

Желательно использовать стандартные символы для более логичных схематических представлений.Показанные формы полупроводников и электронных ламп высокого качества в векторном формате, хорошо масштабируемы и легко редактируются.

Соответствующие символы

Все электрические элементы Edraw поддерживают использование перетаскивания. Некоторые из подходящих символов также поддерживают редактор «укажи и щелкни».

Пример электрической схемы

Следующая электрическая схема создана с помощью программного обеспечения для электрических схем Edraw.Вы можете перетащить нужные электрические символы на холст Edraw, а затем без проблем соединить их.

Как создать электрическую схему

Шаг 1: Подумайте, кто увидит вашу электрическую схему, и решите, должны ли ваши рисунки быть схематичными или графическими.

Шаг 2: Выберите символы электрической схемы из библиотеки форм. Перетащите компоненты на страницу документа.

Шаг 3: Нарисуйте прямые и изогнутые линии между электрическими компонентами, которые представляют соединения проводов. Когда линии пересекаются на холсте, автоматически отображаются их переходы, и вы можете настроить типы переходов по своему вкусу.

Шаг 4: Когда рисунок будет готов, проверьте его и поделитесь с товарищами по команде или экспортируйте его как изображение, файл PDF или Visio.

Больше по теме

Как рисовать электрические схемы

Схемы и логическая схема

Интегрированный Программное обеспечение для схемотехники

Схема системы

Схематическая диаграмма

Промышленные системы управления

Как создать диаграмму цепей

Как читать однолинейную схему

Как читать однолинейные схемы

Обычно мы изображаем систему распределения электроэнергии в виде графического представления, называемого однолинейной схемой (SLD).Одна линия может отображать всю систему или ее часть. Он очень универсален и всеобъемлющ, поскольку может изображать очень сложную трехфазную систему.

Мы используем общепринятые электрические символы для обозначения различных электрических компонентов и их взаимосвязи в цепи или системе. Чтобы интерпретировать однострочные линии, вам сначала нужно познакомиться с электрическими символами. На этой диаграмме показаны наиболее часто используемые символы.

Давайте рассмотрим промышленную однолинейную схему.При интерпретации однолинейной схемы вы всегда должны начинать с вершины, где находится самое высокое напряжение, и постепенно снижаться до самого низкого напряжения. Это помогает поддерживать прямые напряжения и пути их прохождения.

Чтобы это было проще объяснить, мы разделили одну строку на три части.

Диаграмма ниже была создана с помощью бесплатного онлайн-конструктора диаграмм, расположенного на сайте www.draw.io. draw.io online — это бесплатное веб-приложение для всех. Он бесплатен для любого использования, в нем нет платных функций, водяных знаков и т. Д.Вы являетесь владельцем создаваемого вами контента и можете использовать его для любых целей. Вы можете хранить свои проекты draw.io в формате .xml на рабочем столе, в Dropbox или Google Диске. Какой бы вариант хранилища вы ни выбрали, при запуске draw.io вам всегда будет представлен экран с вопросом, хотите ли вы создать новый файл или открыть новый.

Хотя draw.io предоставляет обширный набор библиотек по умолчанию, могут быть случаи, когда вы захотите использовать символы, которые не предоставлены. Если вы можете найти и использовать соответствующие символы, вы можете включить их в настраиваемую библиотеку, которая затем может использоваться так же, как любая из существующих библиотек по умолчанию.Ознакомьтесь с руководством пользователя draw.io и онлайн-уроками, чтобы узнать о базовых и дополнительных параметрах.

Площадь А

Если начать сверху, вы заметите, что трансформатор подает питание на всю систему. Трансформатор понижает напряжение с 35 кВ до 15 кВ, на что указывают числа рядом с символом трансформатора. После понижения напряжения обнаруживается съемный автоматический выключатель (a1). Вы узнали символ съемного автоматического выключателя? Вы можете предположить, что этот автоматический выключатель может выдерживать напряжение 15 кВ, поскольку он присоединен к стороне трансформатора с напряжением 15 кВ, и на однолинейной линии не указано иное.

После выкатного выключателя (a1) от трансформатора он прикрепляется к более толстой горизонтальной линии. Эта горизонтальная линия представляет собой электрическую шину, которая используется для подачи электричества в другие области или цепи.

Площадь Б

Вы заметите, что еще два съемных выключателя (b1 и b2) подключены к шине и питают другие цепи, которые находятся под напряжением 15 кВ, поскольку не было никаких признаков изменения напряжения в системе. Присоединенный к съемному автоматическому выключателю (b1) понижающий трансформатор используется для понижения напряжения в этой области системы с 15 кВ до 5 кВ.

На стороне 5 кВ этого трансформатора показан разъединитель. Разъединитель используется для подключения или изоляции оборудования под ним от трансформатора. Оборудование ниже разъединителя находится под напряжением 5 кВ, поскольку ничто не указывает на обратное. Вы узнаете, что оборудование, прикрепленное к нижней стороне разъединителя, представляет собой два пускателя двигателя среднего напряжения? В зависимости от конкретных системных требований можно подключить несколько пускателей.

Теперь найдите второй съемный автоматический выключатель (b2).Этот автоматический выключатель присоединен к разъединителю с предохранителем и подключен к понижающему трансформатору. Обратите внимание, что все оборудование ниже трансформатора теперь считается оборудованием низкого напряжения, потому что напряжение было понижено до уровня 600 вольт или ниже.

Последней частью электрооборудования в средней части схемы является другой автоматический выключатель (b3). Однако на этот раз автоматический выключатель является стационарным выключателем низкого напряжения, что обозначено символом.Переходя к нижней части однолинейной схемы, обратите внимание, что автоматический выключатель (b3) в середине подключен к шине в нижней части.

Площадь C

Внизу слева, к шине, подключен еще один стационарный выключатель. Внимательно посмотрите на следующую группу символов. Вы узнали символ автоматического включения резерва?

Также обратите внимание, что символ круга, представляющий аварийный генератор, прикреплен к автоматическому переключателю. Эта область однолинейной линии говорит нам о том, что важно, чтобы оборудование, подключенное под автоматическим переключателем, продолжало работать, даже если питание от шины пропадает.По однолинейной схеме можно сказать, что автоматический переключатель резерва подключит аварийный генератор к цепи, чтобы поддерживать работу оборудования, если питание от шины будет потеряно.

Схема управления низковольтным двигателем подключена к автоматическому переключателю через низковольтную шину. Убедитесь, что вы узнали эти символы. Хотя мы не знаем точной функции управления двигателем низкого напряжения в этой цепи, очевидно, что важно поддерживать оборудование в рабочем состоянии.Письменная спецификация обычно предоставляет подробную информацию о приложении.

С правой стороны третьей области есть еще один стационарный выключатель, подключенный к шине. Он прикреплен к центру метра, на что указывает символ, образованный тремя кругами. Это указывает на то, что электрическая компания использует эти счетчики для учета мощности, потребляемой оборудованием ниже центра счетчика.

Ниже центра счетчика находится центр нагрузки или щит, который питает ряд меньших цепей.Это может быть центр нагрузки в здании, который питает свет, кондиционер, отопление и любое другое электрическое оборудование, подключенное к зданию.

Этот чрезмерно упрощенный анализ однолинейной диаграммы дает вам представление о том, какую историю эти диаграммы рассказывают о соединениях электрической системы и оборудовании. Просто имейте в виду, что, хотя некоторые однолинейные диаграммы могут показаться подавляющими из-за своего размера и большого разнообразия представленного оборудования, все они могут быть проанализированы с использованием одного и того же пошагового метода.

Ссылка // Основы распределения электроэнергии от EATON

однолинейных диаграмм | Электронные системы поддержки

Исследование площадки

Осмотр вашей электрической системы на месте — это первый шаг к созданию или обновлению однолинейной схемы. Обученные технические специалисты Vertiv ™ собирают информацию, чтобы определить элементы, которые необходимо удалить или добавить в общую схему. Это создает фундамент знаний.После завершения опроса наша команда создаст новую профессиональную однолинейную диаграмму для ваших записей. Услуги по обследованию площадки следующие:

  • Инвентаризация всего оборудования
  • Подтвердите все нагрузки, подключенные к аварийным / резервным фидерам
  • Проверить потенциальные единственные точки отказа
  • Оценить общий дизайн системы и определить, можно ли поддерживать систему без остановки
  • Проверить наличие процесса обновления чертежей
  • Обновление предоставленных заказчиком однолинейных схем и предоставление версии в формате AutoCAD
  • Предоставьте отчет о результатах с любыми рекомендованными действиями
Разработка однолинейных схем

Однолинейная схема — это план для анализа электрической системы.Это первый шаг в подготовке критического плана реагирования, позволяющий вам досконально ознакомиться с компоновкой и конструкцией системы распределения электроэнергии на вашем предприятии. Типовая диаграмма будет включать:

  • Входящие линии с указанием напряжения и размера
  • Входные главные предохранители, наконечники, вырезы, переключатели и главные / межкоммутаторные выключатели
  • Трансформаторы силовые (номинал, соединение обмоток и средства заземления)
  • Автоматические выключатели и выключатели с предохранителями
  • Реле (назначение, применение и тип)
  • Трансформаторы тока и / или напряжения с размерами, типом и соотношением сторон
  • Трансформаторы управляющие
  • Все основные кабели и провода с соответствующими изолирующими выключателями и наконечниками (размер и длина)
  • Все подстанции, включая встроенные реле и главные панели с общей нагрузкой каждого фидера и каждой подстанции
  • Напряжение и размер критически важного оборудования (ИБП, аккумулятор, генератор, распределение энергии, автоматический выключатель, кондиционирование воздуха в компьютерном зале)
Обзор и обновление однолинейной схемы

После обследования площадки инженеры службы надежности электроснабжения обновят существующие однолинейные схемы или полные чертежи электрических систем по мере необходимости.Это обновление будет включать любые изменения в инфраструктуру, отмечать изменения нагрузки, добавлять недостающие компоненты и исправлять неточную информацию.

Проверка соответствия и безопасности

Многие электрические системы со временем трансформируются, вызывая беспокойство по поводу безопасности. Вот почему NFPA 70E требует точной однолинейной схемы для каждого объекта. Наши сотрудники, состоящие из высококвалифицированных профессионалов, используют свой комплексный опыт и знания нормативных актов в области электротехнической промышленности для обеспечения соблюдения и защиты вашего бизнеса.

Не умаляйте важность однолинейной схемы

Создание и поддержка SLD

Когда здание строится впервые, инженеры-электрики и подрядчики вместе создают SLD с помощью стандартного процесса:

  • Инженер-конструктор разрабатывает компоненты и устройства, которые необходимо установить.
  • Инженер создает допущения, используемые для расчетов тока короткого замыкания, оценки оборудования и выборочной координации.
  • Подрядчик затем выполняет установку, маркируя SLD по мере внесения изменений.Подрядчик часто добавляет длины проводов и учитывает данные паспортной таблички трансформатора и двигателя / генератора, включая импедансы, поскольку добавление электроэнергии может увеличить ток короткого замыкания в системе.
  • Созданы исполнительные чертежи (исходные проектные чертежи, пересмотренные для отражения изменений, внесенных в полевых условиях), в комплекте с обновленными расчетами тока короткого замыкания.

После открытия предприятия все изменения отражаются в SLD с проверкой документации каждые пять лет для обеспечения точности и ясности.


Завершение и обслуживание SLD в соответствии с отраслевыми рекомендациями

Различные разделы NFPA (Национальная ассоциация противопожарной защиты) 70B и 70E предлагают или предписывают создание и обновление SLD. В Разделе 6.2.2.1 NFPA 70B рекомендует, чтобы в SLD отображалось все электрическое оборудование в энергосистеме и указывались все соответствующие номинальные значения для напряжения, частоты, импеданса трансформатора, доступного тока короткого замыкания и OCPD, среди прочего. Кроме того, как указано в разделе 130 NFPA 70E.5 (G): «Анализ падающей энергии должен обновляться, когда происходят изменения в системе распределения электроэнергии, которые могут повлиять на результаты анализа. Анализ падающей энергии также должен проверяться на точность с интервалами, не превышающими пяти лет ».

Но, даже с четкими инструкциями NFPA и процессами создания и обслуживания, SLD часто остаются незавершенными после новой сборки. Руководители строительства часто не обучены пониманию важности SLD и расчетов, основанных на значениях тока короткого замыкания, которые они содержат.Кроме того, SLD редко пересматриваются и обновляются в течение срока службы объекта. Специалисты по управлению и обслуживанию не используют SLD ежедневно, ежемесячно или даже ежегодно. Таким образом, существует риск, что документация окажется в нише хранения или в задней части картотеки и забыта.


Поддерживайте актуальность своего SLD и планируйте обновления

Электрики и специалисты по проектированию полагаются на точные SLD для расчета значений короткого замыкания, которые в конечном итоге определяют падающую энергию.Итак, проявите должную осмотрительность, подготовив и поддерживая документацию SLD. Если вы внесли изменения в инфраструктуру своей электрической системы, убедитесь, что ваши чертежи обновлены. И не забывайте проверять свои SLD каждые пять лет в соответствии с NFPA 70E, независимо от того, внесли вы изменения или нет.

Кроме того, я настоятельно рекомендую создать статью бюджета SLD для учета ресурсов, необходимых для регистрации изменений и проведения пятилетнего обзора документации. Пример промышленного предприятия, на который я ссылался ранее, подчеркивает эту важность.Если бы компания обновляла свои схемы на протяжении многих лет, я бы просто провел исследования короткого замыкания и координации. Вместо этого я часами составлял схему проводки до того, как мог выполнить первоначальный объем работ, что было незапланированными и дорогостоящими расходами. По моему опыту, трата денег на надлежащую документацию в ближайшем будущем снижает вероятность гораздо больших расходов на обслуживание в будущем.

Прикладные науки | Бесплатный полнотекстовый | Новый инструмент САПР для электрических образовательных схем

1.Введение

Инструменты автоматизированного проектирования (САПР) чрезвычайно полезны для многих приложений, таких как дизайн [1,2], инженерия [3,4] или медицина [5,6,7], среди многих других. В этой статье мы сосредоточимся на применении инструментов САПР в образовательном контексте, области, в которой они также оказались действительно полезными инструментами [8,9,10]. Традиционные образовательные модели были сосредоточены на предоставлении студентам необходимых навыков, чтобы превратить их в квалифицированных рабочих. В настоящее время преподаватели больше озабочены обучением студентов тому, как учиться самостоятельно.Технологии изменили не только образ жизни, но и способ обучения. Его можно использовать для обучения и может способствовать развитию как обучения, так и преподавания, если применять его с учетом принципов обучения.

Technology связывает учащихся не только с учителями, но и с ресурсами и профессиональным контентом или системами, которые могут помочь им в процессе обучения, позволяя им выбирать собственный темп обучения. В этом контексте мы представляем CADDi, инструмент САПР для проектирования электрических схем.CADDi — это система поддержки домашних заданий, которая не только предоставляет студентам ресурсы для практики своего предмета, но и является инструментом самооценки, позволяющим им проверять свои реальные достижения. Используя CADDi, учащиеся могут проектировать электрические схемы, автоматически преобразовывать схемы в их представление в виде лестничных диаграмм (с акцентом на демонстрацию их функциональности) и проверять его рабочее поведение в интерактивном режиме. Он был задуман как веб-страница для поддержки обучения.

Инженерные степени имеют общие предметы в первые годы обучения, чтобы дать студентам необходимые компетенции, чтобы стать инженером.Одна из таких распространенных тем — промышленный дизайн [11]. Помимо других навыков, он дает студентам знания и умения создавать и интерпретировать планы и диаграммы в промышленной сфере. Он включает в себя, среди прочего, технические чертежи, электрические и электронные схемы или планы наставлений. Студенты должны иметь базовые знания в области электричества и электроники, чтобы составлять технические схемы, но на этом этапе, еще в первые годы обучения, большинство из них сталкиваются с трудностями в правильном понимании и решении этой конкретной темы, хотя концепции просты. .Существующие коммерческие инструменты либо слишком просты для создания диаграмм с целью хорошего внешнего вида, либо слишком сложны для проектирования профессиональных систем (см. Обзор литературы в разделе 3).

Эта ситуация демонстрирует явный пробел, обусловленный необходимостью инструментов, помогающих студентам в этой теме. В этой статье мы предлагаем специальный инструмент для этого. Кроме того, мы применили знание формальных языков для создания специализированного языка программирования. Применение этой техники позволяет создавать специальные языки для проектирования электрических схем, которые также проверяют правильность предложенной системы.Это не только помогает учащимся учиться, но и обогащает их творческий потенциал с помощью инструмента, который позволяет им создавать любую диаграмму, которую они представляют, проверять ее жизнеспособность и автоматически получать соответствующую лестничную диаграмму.

Основным вкладом этой работы является CADDi, новый инструмент САПР для (i) проектирования электрических схем, (ii) автоматического создания их лестничных диаграмм и (iii) моделирования их поведения. Инструмент реализован в виде веб-страницы с целью сделать ее свободно доступной для всех с любого устройства с браузером.Кроме того, мы также предлагаем WDLang, новый и простой в изучении язык программирования, специально разработанный для описания электрических цепей. Он разработан и реализован в соответствии с теорией формальных языков [12,13]. WDLang является краеугольным камнем CADDi, который использует грамматику, определяющую его, для автоматического создания лестничной диаграммы электрической цепи. Решение проблемы проектирования электрических цепей с помощью теории формальных языков — это инновационный метод, который позволяет построить абстрактное формальное представление схемы, общее для всех различных диаграмм, и, следовательно, легко позволяет генерировать лестничную диаграмму из проводной. .Предлагаемый нами инструмент позволяет студентам: (1) практиковаться независимо от лекций, в своем темпе и их уровне, (2) создавать новые диаграммы, которые не видны в классе, (3) проверять, действительно ли они понимают преподаваемые концепции, и, наконец, (4 Работа организована следующим образом: следующий раздел знакомит с понятием электрической схемы, а также с двумя типами, рассматриваемыми в данной работе: электрическими схемами и лестничными диаграммами. В разделе 3 содержится краткий обзор существующих в литературе программ для проектирования и реализации электрических систем.Предлагаемый инструмент САПР CADDi и специальный язык программирования WDLang, созданный для этой работы, описаны в разделах 4 и 5 соответственно. В Разделе 6 подробно описывается новый графический пользовательский интерфейс CADDi. Наконец, раздел 7 завершает статью.

2. Электрические схемы

Согласно UNE-EN ISO 10209: 2012 [14], диаграмма (в обрабатывающей промышленности) представляет собой рисунок с использованием графических символов, который показывает функции объектов, составляющих систему, и их взаимосвязи. Графический символ также определяется Международной организацией по стандартизации (ISO) как визуально воспринимаемый рисунок, используемый для передачи информации независимо от языка [15].Следовательно, электрические схемы изображают взаимодействие и физические соединения компонентов, составляющих электрические цепи, посредством символических представлений. Символы определены стандартом ISO 14617 [16].

В этой работе мы сосредоточимся на двух разных типах электрических схем: проводке и лестнице. Первый дает информацию о реальном относительном физическом положении и расположении элементов, составляющих устройства или установки. Он используется для построения электрических систем и помогает при поиске и устранении неисправностей.Последний объясняет функционирование схемы, поскольку дает информацию о взаимодействии и зависимостях между элементами. Он представляет собой поток каждой ветви электроэнергии от одной линии к другой.

Инженеры должны владеть обоими типами диаграмм при проектировании электрической системы. Таким образом, одна из основных целей предмета «Промышленный дизайн» — научить студентов инженерных специальностей умениям, необходимым для преобразования электрической схемы в лестничную. Процесс в высшей степени механический, с некоторыми основными правилами, такими как: (i) проводники изображаются в виде горизонтальных или вертикальных линий; (ii) на обеих диаграммах ровно одинаковое количество элементов; (iii) проводники нельзя пересекать на лестничных диаграммах или (iv) на лестничных диаграммах элементы одного и того же компонента могут быть размещены отдельно (например,(например, переключатели и катушка в реле), однако при подключении они должны быть размещены вместе и т. д. На рис. 1а, б показан пример каждого типа схемы простой цепи. На рисунке 1а показана электрическая схема электрической цепи. Работа системы вряд ли станет понятной до тех пор, пока каждое соединение не будет тщательно проверено, хотя это очень простая система. Однако относительное физическое расположение заметно с первого взгляда. На рисунке 1b представлена ​​лестничная диаграмма проводки, описанная выше.Эта диаграмма графически объясняет зависимости между компонентами схемы и ее работой. Для каждого набора зависимых элементов есть одна горизонтальная линия. На этой конкретной диаграмме нет ни информации о физическом расположении компонентов, ни их относительных расстояниях. Однако мы можем легко проверить функциональность схемы и зависимости между компонентами. В показанной схеме есть два разных способа включения трех ламп. С одной стороны, при изменении положения Commuter Q1 сразу активируются все лампы.Они отключают перевод Q1 в исходное состояние. С другой стороны, мы можем наблюдать, что при нажатии любой из трех кнопок S2, S3 или S4 реле K1 возбуждается, и два связанных с ним переключателя изменяют свое состояние. Один из них включает три лампы h2, h3 и h4, а другой переключатель служит механизмом обратной связи, который поддерживает реле в возбужденном состоянии, так что лампы продолжают гореть, пока не будет нажата кнопка S1. Кроме того, есть также три звонка Z1, Z2 и Z3, каждый из которых связан с кнопками S5, S6 и S7 соответственно.

Преобразование монтажной схемы в лестничную осуществляется напрямую, если применяются определенные правила. Однако большинство студентов инженерных специальностей в первые годы учебы в университете не очень хорошо знакомы с основами электричества и испытывают трудности с пониманием этого процесса. Существующие коммерческие программные инструменты представляют собой либо графические инструменты для создания красивых диаграмм, но без функциональности, либо очень сложное программное обеспечение для проектирования реальных установок, способное интегрировать различные аспекты в одну и ту же модель.Далее мы представляем некоторые из наиболее актуальных программных инструментов, доступных в литературе, для создания и проектирования электрических систем.

3. Обзор литературы

На рынке имеется большой список коммерческого программного обеспечения для создания электрических схем или проектирования электрических систем по разным ценам. В основном их можно разделить на две категории. Первый предлагает простой в использовании и быстрый программный инструмент для создания красивых диаграмм, готовых к печати, без каких-либо функций, и требует опыта и знаний пользователя для обеспечения правильности диаграммы.Вторая категория включает инструменты для профессионального проектирования электрических систем с фактическим моделированием и проверкой для поиска несоответствий в системе. Самые продвинутые из них также обеспечивают среду для совместной работы в реальном времени с другими дисциплинами, такими как механика или автоматизация. Далее мы кратко упомянем некоторые из наиболее актуальных программных инструментов в обеих категориях.

3.1. Программные инструменты для рисования электрических схем
Дэн Уэйд создал EZ Schematics [17], простую в использовании программу, которая позволяет разрабатывать и печатать электрические схемы или схемы соединений, которые выглядят профессионально.Он оснащен различными библиотеками символов, основанными на стандартах, выпущенных Национальной ассоциацией производителей электрооборудования (NEMA) или стандартами, включенными в Международную электротехническую комиссию (IEC), такими как однополюсные тормоза, кнопки или предохранители. Он также включает символы трех фаз, гидравлические клапаны или приводы. Кроме того, программное обеспечение позволяет создавать собственные символы. Edraw Max [18] — это программное обеспечение для визуализации, которое дает профессионально выглядящие диаграммы, интеллектуальные карты, диаграммы UML и электрические инженерные диаграммы.Он предоставляет более 2000 электрических символов для создания и представления электрических схем простым и быстрым способом с красивым внешним видом. Electra E8 [19] — это простое и интуитивно понятное программное обеспечение для проектирования электрических схем, которое предоставляет более 700 стандартизованных символов, которые могут превратиться во многие другие. Он основан на Microsoft Visio, поэтому знаком всем, кто использует Microsoft Office.
3.2. Программные инструменты для проектирования электрических систем
The Constructor [20] — это электрическая программа, которая не только позволяет быстро и легко создавать и распечатывать релейные диаграммы, схемы диаграмм и однострочные диаграммы, но также обеспечивает тестирование и устранение неисправностей. к функциональным возможностям схемотехнического моделирования.Эта возможность имеет решающее значение для сужения проблем на ранних этапах, до монтажа проводки в полевых условиях. Он может моделировать простые, сложные и даже трехфазные электрические схемы. Он содержит более 800 символов, включая символы управления / питания NEMA и IEC, а также различные графические, электронные и однострочные символы. Профессиональная версия Automation Studio P6 предлагает мощное решение для проектирования электрических систем [21] и обеспечивает анализ, диагностику и проверку. инструменты для обнаружения ошибок и несоответствий.Он полностью поддерживает стандарты IEC и NEMA и позволяет настраивать символы. Он также включает представление черного ящика, которое заменяет сложный компонент только его контуром. Это многопользовательская среда, позволяющая безопасно совместно использовать проект и связывать внешние процессы с другими корпоративными приложениями. Elecworks [22] — это программное обеспечение CAD для проектирования электрических установок и проектов автоматизации. Имеет большую схематическую библиотеку стандартных символов, которые можно помечать, редактировать.Его терминалы могут быть даже пронумерованы, и он также поддерживает представление черного ящика. Он позволяет рисовать как однолинейные, так и многолинейные схемы. Одна из главных особенностей Elecworks — возможность совместной работы в реальном времени. Elecworks предлагает полную интеграцию, так что электрики и механики могут работать вместе над одной и той же цифровой моделью, как в 2D, так и с 3D моделью проекта.

С образовательной точки зрения, хотя эти существующие программные инструменты могут быть полезны для других целей, они не подходят для нашего случая.Основная причина заключается в том, что ни один из существующих инструментов не преобразует электрическую схему в лестничную, и наоборот, что является основной концепцией, которую должны усвоить студенты. Следовательно, требуется специальное программное обеспечение, которое не только преобразует один тип диаграммы в другой, но также позволяет студентам проводить самооценку.

4. Инструмент CAD для электрических схем — CADDi

Студенты инженерных специальностей приобретают различные компетенции во время учебы. Они изучают такие навыки, как графическое представление, создание и понимание технического чертежа или любого типа плана, такого как механический чертеж, электронный чертеж, топография или электрические схемы.В первые годы учебы в университете они еще не знакомы с электричеством и испытывают трудности с пониманием этой темы. Кроме того, для решения этой конкретной проблемы отсутствуют доступные ресурсы. Студенты вряд ли могут самостоятельно найти и проверить свои компетенции дома.

Как уже упоминалось в разделе 3, в литературе мы можем найти либо инструменты для создания профессиональных электрических схем и / или схем, готовых к печати и демонстрации, но без функциональных возможностей и уверенности в правильности, либо очень мощные профессиональные инструменты для передовое проектирование систем, доступное для пользователей с большим опытом и знаниями в области электричества.В этой работе мы представляем CADDi, инструмент автоматизированного проектирования, который позволяет студентам кодировать, используя определенный язык программирования для схем подключения, очень простой для понимания и интуитивно понятный (поясняется далее в Разделе 5), и он автоматически проверяет его правильность и в таком случае преобразует его в соответствующую лестничную диаграмму. Дополнительно можно смоделировать схемы и проверить поведение схемы. Например, если мы щелкаем мышью по кнопкам, они изменяют свое состояние, позволяя электричеству проходить по цепи или предотвращая это (например,g., они закрываются, если они были открыты, или открываются, если они были закрыты). Если кнопка обслуживала лампу, она загорится, а если это был звонок, она перейдет в состояние звонка.

Насколько нам известно, CADDi — это первый инструмент САПР, способный создавать электрические схемы, обеспечивать их правильность и преобразовывать их в лестничные. Он был специально разработан для учебных целей. У него есть несколько преимуществ, которые делают его особенно полезным для студентов инженерных специальностей:

  • это вспомогательный инструмент для выполнения домашних заданий, потому что учащимся трудно найти решенные упражнения, в которых появляется как проводка, так и соответствующая ей лестничная диаграмма;

  • это инструмент самооценки, потому что учащиеся могут проверить, является ли предлагаемое ими решение лестничной диаграммы, которое соответствует конкретной схеме подключения, правильное или нет;

  • доступность, поскольку она реализована в виде веб-страницы, поэтому нет необходимости в установке программного обеспечения, несовместимости операционных систем или требований к оборудованию, кроме того, что предлагают большинство устройств;

  • удобный графический интерфейс пользователя.

5. Особый язык программирования для схем подключения — WDLang

WDLang, сокращение от Wired Diagrams Language, — это простой, интуитивно понятный, легкий в использовании, очень выразительный, однозначный и правильный язык программирования. Язык формально определяется через контекстно-свободную грамматику, описанную с использованием нотации Бэкуса-Наура (BNF) в таблице 1, где терминалы представлены в кавычках, а 1 * означает, что следующее повторяется один или несколько раз. Идея WDLang заключается в определении каждого отдельного элемента, составляющего электрическую схему и ее соединения.Список доступных элементов приведен в Таблице 2 вместе с их метками в WDLang (в столбце ID), их количеством соединений и символом, представляющим их, в соответствии со стандартом UNE-EN ISO 10209: 2012 [14]. Схема просто кодируется как последовательность компонентов, каждый в отдельной строке. WDLang не определяет никаких функций, циклов, переменных или методов, стремясь определить простой язык, который может быть быстро изучен пользователем. В WDLang инструкции используются для описания компонентов схемы.Каждый компонент и электрический узел на электрической схеме должен быть идентифицирован программистом, а инструкции должны включать (i) метку компонента, как показано в таблице 2, (ii) уникальный идентификатор элемента и (iii) список электрических узлов, к которым он подключен. Поэтому инструкция, определяющая какой-то конкретный компонент, будет представлена ​​следующим образом: где ID, ID1 и ID2 — уникальные идентификаторы (т. е. числа) для элемента и электрических узлов (или соединений) соответственно.На рисунке 2 мы показываем простую электрическую схему и то, как ее можно закодировать в WDLang. Схема состоит из трех компонентов, а именно предохранителя, кнопки открытия и лампы. Эти элементы помечены как F1, S1 и h2, соответственно, в соответствии со стандартом UNE-EN ISO 10209: 2012 [14]. Поскольку стандартные теги для разных элементов одной категории имеют одинаковые метки, нам нужно определить определенные метки для каждого компонента в WDLang. Эти элементы определены в WDLang как F, SO и H соответственно.Предохранитель подключен к L1 и C1, кнопка находится между C1 и C2, а лампа подключена к C2 и L2. Следовательно, схема будет представлена ​​в WDLang как:
F1 (L1, C1) // Предохранитель (F1)
SO1 (C1, C2) // Кнопка открытия (S1)
h2 (C2, L2) // Лампа (h2)
Как видно из таблицы 2, все компоненты имеют 2 разъема, но:
  • Commuter: он имеет три клеммы.

  • Реле: может иметь от 4 до 18 клемм. Первые две клеммы — это вход питания и выход реле. Остальное — это выводы его переключателей. Реле может иметь от 1 до 8 переключателей.

  • Реле с автоматическим включением и реле с автоматическим отключением: они имеют те же соединения, что и обычное реле.

Чтобы лучше объяснить состав инструкций, требуемых WDLang, мы включили в рисунок 3 ту же схему соединений, что и в примере, представленном на рисунке 1a, но где все электрические узлы схемы были однозначно идентифицированы.Мы представляем в алгоритме 1 код, соответствующий типовой диаграмме, показанной на рисунках 1 и 3. Как можно видеть, инструкции начинаются с типа элемента, за которым следует его уникальный идентификатор (который в этом примере установлен на тот же один как метка на отображаемой диаграмме). Следовательно, алгоритм 1 означает, что пригородный «SW1» (обозначенный на схеме как Q1) подключен к кабелям «C1», «C2» и «C4», где также «h2», «h3» и «h4». как один из связанных переключателей «K1», тоже подключены.Комментарии можно добавлять, как в языке C: либо писать «//» в начале строки, либо заключать несколько последовательных строк между «/ *» и «* /».
Алгоритм 1 Пример кода для диаграммы на рисунке 1a.
1: F1 (L1, C1) // Предохранитель F1
2: SW1 (C1, C2, C4) // Пригородный Q1
3: SO1 (C2, C3) // Кнопка размыкание S1
4: KM1 (C3, C5, C3, C4, C5, L2) / * Реле K1, с двумя
5: связанные контакты * /
6: SC2 (C5, L2 ) // 3 кнопки включения: S2, S3, S4, подключенные параллельно
7: SC3 (C5, L2)
8: SC4 (C5, L2)
9: F2 (L1 , C6) // Предохранитель F2
10: SC5 (C6, C7) // 3 звонка (Z1, Z2, Z3), подключенные к 3 кнопкам (S5, S6, S7)
11: SC6 ( C6, C8)
12: SC7 (C6, C9)
13: Z1 (C7, L2)
14: Z2 (C8, L2)
15: Z3 (C9, L2)
16: h2 (C4, L2) // Три лампы, h2, h3, h4, подключенные параллельно
17: h3 (C4, L2)
18: h4 (C4, L2)

6.Графический интерфейс CADDi

Доступность была сильным требованием в нашем дизайне. Когда мы впервые планировали внедрение электрического программного инструмента, мы считали важным быть независимыми от аппаратного обеспечения и операционной системы. Никаких инсталляций не требуется. Таким образом, CADDi задумывался как веб-сайт.

На рис. 4 показан снимок экрана веб-сайта CADDi. Он был реализован с использованием библиотеки JointJS [23], которая предлагает обширный API для создания расширенных приложений HTML 5. Эта библиотека позволяет визуализировать и взаимодействовать с диаграммами, и она сильно зависит от событий, поэтому возможны реакции на события, происходящие внутри бумаги.Как уже упоминалось в разделе 4, кнопки, переключатели и переключатели могут быть активированы и / или отключены с помощью простых щелчков мыши, что, в свою очередь, изменяет поток электричества в цепи, так что ее работа визуализируется. Рисунки 5 и 6 показывают пример того, как представлена ​​работа схемы. Нарисована базовая диаграмма, на которой кнопка активирует звонок, а при нажатии на нее загорается лампа. Начальное состояние представлено на рисунке 5, и когда щелчок мышью выполняется над кнопкой, он меняет состояние (в течение заранее определенного времени) и позволяет циркулировать электричество, включая затем лампу и звонок, как показано на рисунке. 6.

В CADDi есть два режима работы. С одной стороны, можно создать релейную диаграмму прямо на холсте, щелкнув доступные символы и проверив ее функциональность. С другой стороны, можно запрограммировать схему соединений с помощью WDLang и автоматически преобразовать ее в соответствующую лестничную диаграмму. Далее мы объясним оба подхода.

6.1. Создание лестничных электрических схем с помощью графического интерфейса пользователя CADDi
Большое количество наиболее часто используемых электрических компонентов в образовательных схемах реализовано в CADDi.На рисунке 4 показан снимок экрана с графическим интерфейсом CADDi. Первоначально веб-сайт CADDi предлагает простой холст с двумя вертикальными линиями, представляющими L1 и L2, каждая на одной стороне листа. Различные символы, которые можно использовать, показаны как с правой, так и с левой стороны холста. Щелчок мышью по символу меню добавляет его на холст. Символы могут быть соединены с другими символами, перемещены, повернуты или удалены. Чтобы установить соединение между компонентами, необходимо щелкнуть по одному терминалу, L1 или L2, и перетащить мышью на желаемый терминал другого компонента, L1 или L2.Как только соединение установлено, компоненты можно перемещать, а их соединения остаются стабильными. Зависимости также можно установить в CADDi. Реле состоит из катушки и нескольких контактов. Когда катушка возбуждена, соответствующие контакты меняют свое состояние. Чтобы создать эту ассоциацию в CADDi, необходимо перетащить связанные контакты по катушке и отпустить кнопку мыши. В этот момент установлена ​​функциональная зависимость. Можно снимать и переворачивать компоненты с холста, просто щелкнув по нему правой кнопкой мыши.Весь холст будет очищен после щелчка по нему правой кнопкой мыши.
6.2. Использование WDLang для проектирования электрических схем соединений
Как упоминалось ранее, CADDi имеет пользовательский интерфейс, который напрямую преобразует схему соединений в лестничную. Схема должна быть закодирована с использованием WDLang, как описано в Разделе 5. На веб-странице есть кнопка вставки кода для загрузки файла. Затем этот код обрабатывается, и появляется соответствующая лестничная диаграмма. Диаграмму можно легко изменить, добавив новые элементы, удалив некоторые из них, переместив их или изменив маршрут проводов, соединяющих их.Когда компонент перемещается, его соединения сохраняются. Эта функция добавлена ​​для упрощения понимания схемы в случае, если элементы автоматически сгенерированной схемы расположены неправильно. На рисунке 7 показан снимок экрана с включенным кодом.

7. Выводы и дальнейшая работа

В этой работе мы представляем CADDi и WDLang. Первый — это инструмент САПР, помогающий студентам-инженерам понять основные электрические концепции, создавать электрические схемы и преобразовывать проводку в лестничные.Последний, WDLang, представляет собой новый язык программирования, помогающий CADDi. Полученное в результате адаптированное программное обеспечение позволяет пользователю проектировать, создавать и моделировать электрические схемы либо с использованием пользовательского графического интерфейса, либо с помощью WDLang. Это также дает возможность легко трансформировать электрические схемы проводки в лестничные. Простота предлагаемого языка программирования WDLang обеспечивает быстрое обучение и удобство использования.

В будущем мы планируем улучшить CADDi путем определения большего количества электрических компонентов, а также с помощью инструмента, позволяющего разрабатывать индивидуальные компоненты.Кроме того, будет очень интересно выяснить, может ли CADDi поддерживать трехфазные диаграммы.

Мы не можем найти эту страницу

(* {{l10n_strings.REQUIRED_FIELD}})

{{l10n_strings.CREATE_NEW_COLLECTION}} *

{{l10n_strings.ADD_COLLECTION_DESCRIPTION}}

{{l10n_strings.COLLECTION_DESCRIPTION}} {{добавить в коллекцию.description.length}} / 500 {{l10n_strings.TAGS}} {{$ item}} {{l10n_strings.PRODUCTS}} {{l10n_strings.DRAG_TEXT}}

{{l10n_strings.DRAG_TEXT_HELP}}

{{l10n_strings.LANGUAGE}} {{$ select.selected.display}}

{{article.content_lang.display}}

{{l10n_strings.АВТОР}}

{{l10n_strings.AUTHOR_TOOLTIP_TEXT}}

{{$ select.selected.display}} {{l10n_strings.CREATE_AND_ADD_TO_COLLECTION_MODAL_BUTTON}} {{l10n_strings.CREATE_A_COLLECTION_ERROR}}

Что такое однолинейная электрическая схема?

Что означает однолинейная электрическая схема?

Однолинейная диаграмма (SLD) считается важным инструментом для профессионалов-электриков. SLD — это программа для анализа электрических систем. Он представляет собой трехфазную систему питания.Это форма блок-схемы, которая показывает пути потока мощности между различными объектами системы.

При работе как в старых, так и в новых зданиях инженеры-электрики полагаются на однолинейную схему для отслеживания электрических компонентов, чтобы обеспечить надлежащее техническое обслуживание и меры безопасности.

Safeopedia объясняет однолинейную электрическую схему

Использование SLD

Он работает по-разному в сбалансированной и несбалансированной системе.

  1. В трехфазной энергосистеме каждая фаза рассматривается отдельно, если нагрузка балансируется отдельно в каждой фазе. Могут быть несимметричные повреждения на одной или двух фазах. Итак, здесь SLD используется вместе с упрощением обозначений.
  2. При использовании метода симметричных компонент, отдельные однолинейные диаграммы строятся для каждой из систем прямой, отрицательной и нулевой последовательности.

Создание и обслуживание SLD

После завершения строительства здания инженеры и строитель вместе работают над устранением опасностей, связанных с электроснабжением.Процесс идет поэтапно.

  1. Инженер-конструктор определяет компоненты и устройства, которые необходимо установить.
  2. Инженер создает допущения, используемые для оценки расчетов тока короткого замыкания и выборочной координации.
  3. Подрядчик устанавливает SLD, размечая SLD по мере внесения изменений.
  4. Созданы оригинальные проектные чертежи, пересмотренные с учетом изменений, внесенных в поле.

Важность SLD

  1. Это основной ресурс для расчета токов короткого замыкания, определения выборочной координации и, в конечном итоге, расчета падающей энергии.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *