Gyd 9e: GYD-9E GYD-540-530MM-24W-96LED универсальный набор подсветки купить

Содержание

Gyd 9e подключение к монитору

Введение

И так, когда-то очень-очень давно, я покупал пару мониторов Samsung SyncMaster 943n. Мониторы мне эти очень нравились. Хорошее качество, приятная картинка, диагональ 19 дюймов (да-да, когда то это было достаточно круто). Но со временем, у них начали садиться лампы. Один из мониторов я благополучно продал, а другой остался у меня. В какой-то момент я заменил в нём лампы, но все, же около года назад, монитор стал выключать подсветку, сразу после включения.

Конечно, к тому времени необходимости в нём уже особой не было, в работе были уже мониторы 22 дюйма, а старичок остался на память. После года ожидания (всё никак не доходили руки починить), я всё же взялся за старый монитор т. к. мне потребовался какой-нибудь монитор, чтобы отправить его на ПМЖ в сад для родителей.

Так как менять лампы не целесообразно, в мониторе их аж 4, по 2 сверху и снизу, я решил поставить LED подсветку. Так сказать стильно, модно, современно. Да и по цене выходит даже дешевле.

Выбор пал вот на такой драйвер (GYD-9E) с двумя светодиодными планками.

Замена ламп

И так, приступим. Для начала, необходимо выполнить самую кропотливую, как я считаю работу — разобрать экран монитора и заменить старые лампы новыми светодиодными планками.

Далее, после полной разборки монитора, снимаем короба с лампами со стекла. Как видно по фото, у меня лампы вышли из строя из-за оплавления контактов.

Теперь, вынимаем старые лампы и очищаем металлические короба от мусора, остатков ламп и пр. Желательно немного обезжирить поверхность крепления диодных линеек. Я для этого использую изопропиловый спирт.

Далее потребуется подогнать размер линеек под короба. Увы, но подогнать именно ровно по длине не выйдет, т. к. диоды с линеек надо отрезать по 3 шт. Таким образом, примеряем линейки так, чтобы поместилось максимальное количество диодов, но при этом, отрезая от линейки их по 3 шт. Я отрезал по 6 диодов от каждой линейки, у меня вышло вот так.

Ну, а дальше всё обратном порядке. Собираем экран строго в обратной последовательности, внимательно все, проверяя на каждом этапе сборки, защёлкивая все клипсы и крепления, чтобы в дальнейшем не пришлось разбирать всё снова.

Установка драйвера

Ну вот, с экраном разобрались. Теперь займёмся платой монитора и драйвером управления.
Так как блок инвертора на плате нам больше не требуется, я частично демонтировал детали схемы инвертора, тем самым отключив сам инвертор и положив несколько деталей в закрома.

Как видно по фотографии, я снял трансформатор инвертора, выходные ёмкости, предохранитель и прочий мелкий обвес. Тут ничего сложного. Кому ничего этого не требуется, могут просто снять в данной цепи предохранитель и всё.

Теперь переходим к самому интересному — установке драйвера подсветки. При установке драйвера подсветки, основной особенностью работы самого драйвера является регулировка яркости нашей будущей подсветки. Есть несколько нюансов с инвертирование управления и пр. Расскажу несколько подробнее.

Канал регулировки драйвера подсветки можно подключить к одной из 2-х шин на блоке монитора: A-Dim или B-Dim. Отличие сигналов состоит в том, что первый используется для аналоговой регулировки яркости. Сигнал A-Dim формируется микропроцессором монитора и изменяет величину напряжения постоянного тока. Увеличение сигнала A-Dim приводит к увеличению напряжения обратной связи и наоборот. Правда при регулировке яркости с панели управления монитора, значение изменяется только в пределах от 1 до 10 единиц.

Если же вам регулировка по каналу A-Dim покажется недостаточно удобной, то вы можете воспользоваться каналом B-Dim, но тогда вам придётся модифицировать схему драйвера, т. к. при подключении к каналу B-Dim вы получите инвертированное управление. Т. е. при увеличении яркости в меню, подсветка будет становиться тусклее, а при уменьшении яркости — ярче. Если вам это не важно, или подсветка и так вас устраивает, то подключайте к шине A-Dim и не парьтесь. Я поступил именно так. Если изучить вопрос более детально, я рекомендую вам вот эту статью. Всё очень понятно и доходчиво написано, а так же имеются схемы модификации драйвера.

Осталось разобрать, что и куда подключать. У нас имеются следующие провода на драйвере:

  1. VIN — плюс питания DC 10-24V (красный провод)
  2. ENA — отключение/включение подсветки 0 — 3,3V (желтый провод)
  3. DIM — регулировка яркости светодиодов 0,8 — 2,5V (желтый провод)
  4. GND — минус питания (черный провод)

Осталось определиться, куда припаять их на плате монитора.
Тут тоже всё достаточно просто. Внимательно смотрим на плату, там всё подписано. Таким образом, моя схема подключения драйвера выглядит вот так:

  1. VIN2 контакт разъёма монитора.
  2. ENA8 контакт разъёма монитора.
  3. DIM7 контакт разъёма монитора.
  4. GND3 контакт разъёма монитора.

Собираем, проверяем. Всё работает.

Даже на полной яркости работа подсветки меня устраивает. Но работа по такому типу подключения накладывает ограничения, о которых я писал выше, при регулировке яркости, сила подсветки меняется только на первых 10 делениях. Т. е. в меню вся шкала составляет от 0 до 100, яркость изменяется только на этапе от 0 до 10, на этапе от 11 до 100 уже ничего не меняется, яркость находится в максимальном значении. Более понятно я думаю, станет, если вы сами поэкспериментируете и решите для себя, как вам больше подходит. Меня же устроил и такой вариант.

Введение

И так, когда-то очень-очень давно, я покупал пару мониторов Samsung SyncMaster 943n. Мониторы мне эти очень нравились. Хорошее качество, приятная картинка, диагональ 19 дюймов (да-да, когда то это было достаточно круто). Но со временем, у них начали садиться лампы. Один из мониторов я благополучно продал, а другой остался у меня. В какой-то момент я заменил в нём лампы, но все, же около года назад, монитор стал выключать подсветку, сразу после включения.

Конечно, к тому времени необходимости в нём уже особой не было, в работе были уже мониторы 22 дюйма, а старичок остался на память. После года ожидания (всё никак не доходили руки починить), я всё же взялся за старый монитор т. к. мне потребовался какой-нибудь монитор, чтобы отправить его на ПМЖ в сад для родителей.

Так как менять лампы не целесообразно, в мониторе их аж 4, по 2 сверху и снизу, я решил поставить LED подсветку. Так сказать стильно, модно, современно. Да и по цене выходит даже дешевле.

Выбор пал вот на такой драйвер (GYD-9E) с двумя светодиодными планками.

Замена ламп

И так, приступим. Для начала, необходимо выполнить самую кропотливую, как я считаю работу — разобрать экран монитора и заменить старые лампы новыми светодиодными планками.

Далее, после полной разборки монитора, снимаем короба с лампами со стекла. Как видно по фото, у меня лампы вышли из строя из-за оплавления контактов.

Теперь, вынимаем старые лампы и очищаем металлические короба от мусора, остатков ламп и пр. Желательно немного обезжирить поверхность крепления диодных линеек. Я для этого использую изопропиловый спирт.

Далее потребуется подогнать размер линеек под короба. Увы, но подогнать именно ровно по длине не выйдет, т. к. диоды с линеек надо отрезать по 3 шт. Таким образом, примеряем линейки так, чтобы поместилось максимальное количество диодов, но при этом, отрезая от линейки их по 3 шт. Я отрезал по 6 диодов от каждой линейки, у меня вышло вот так.

Ну, а дальше всё обратном порядке. Собираем экран строго в обратной последовательности, внимательно все, проверяя на каждом этапе сборки, защёлкивая все клипсы и крепления, чтобы в дальнейшем не пришлось разбирать всё снова.

Установка драйвера

Ну вот, с экраном разобрались. Теперь займёмся платой монитора и драйвером управления.
Так как блок инвертора на плате нам больше не требуется, я частично демонтировал детали схемы инвертора, тем самым отключив сам инвертор и положив несколько деталей в закрома.

Как видно по фотографии, я снял трансформатор инвертора, выходные ёмкости, предохранитель и прочий мелкий обвес. Тут ничего сложного. Кому ничего этого не требуется, могут просто снять в данной цепи предохранитель и всё.

Теперь переходим к самому интересному — установке драйвера подсветки. При установке драйвера подсветки, основной особенностью работы самого драйвера является регулировка яркости нашей будущей подсветки. Есть несколько нюансов с инвертирование управления и пр. Расскажу несколько подробнее.

Канал регулировки драйвера подсветки можно подключить к одной из 2-х шин на блоке монитора: A-Dim или B-Dim. Отличие сигналов состоит в том, что первый используется для аналоговой регулировки яркости. Сигнал A-Dim формируется микропроцессором монитора и изменяет величину напряжения постоянного тока. Увеличение сигнала A-Dim приводит к увеличению напряжения обратной связи и наоборот. Правда при регулировке яркости с панели управления монитора, значение изменяется только в пределах от 1 до 10 единиц.

Если же вам регулировка по каналу A-Dim покажется недостаточно удобной, то вы можете воспользоваться каналом B-Dim, но тогда вам придётся модифицировать схему драйвера, т. к. при подключении к каналу B-Dim вы получите инвертированное управление. Т. е. при увеличении яркости в меню, подсветка будет становиться тусклее, а при уменьшении яркости — ярче. Если вам это не важно, или подсветка и так вас устраивает, то подключайте к шине A-Dim и не парьтесь. Я поступил именно так. Если изучить вопрос более детально, я рекомендую вам вот эту статью. Всё очень понятно и доходчиво написано, а так же имеются схемы модификации драйвера.

Осталось разобрать, что и куда подключать. У нас имеются следующие провода на драйвере:

  1. VIN — плюс питания DC 10-24V (красный провод)
  2. ENA — отключение/включение подсветки 0 — 3,3V (желтый провод)
  3. DIM — регулировка яркости светодиодов 0,8 — 2,5V (желтый провод)
  4. GND — минус питания (черный провод)

Осталось определиться, куда припаять их на плате монитора.
Тут тоже всё достаточно просто. Внимательно смотрим на плату, там всё подписано. Таким образом, моя схема подключения драйвера выглядит вот так:

  1. VIN2 контакт разъёма монитора.
  2. ENA8 контакт разъёма монитора.
  3. DIM7 контакт разъёма монитора.
  4. GND3 контакт разъёма монитора.

Собираем, проверяем. Всё работает.

Даже на полной яркости работа подсветки меня устраивает. Но работа по такому типу подключения накладывает ограничения, о которых я писал выше, при регулировке яркости, сила подсветки меняется только на первых 10 делениях. Т. е. в меню вся шкала составляет от 0 до 100, яркость изменяется только на этапе от 0 до 10, на этапе от 11 до 100 уже ничего не меняется, яркость находится в максимальном значении. Более понятно я думаю, станет, если вы сами поэкспериментируете и решите для себя, как вам больше подходит. Меня же устроил и такой вариант.

мир электронных мыслей

Вы здесь

Установка LED подсветки в монитор Samsung 2343NW

В первой части статьи мы рассмотрели работу подсветки на лампах CCFL, для которых необходимо сверхвысокое напряжение. Инвертор, выдающий такое напряжение, должен следить за током ламп, согласовывать выходной каскад инвертора со входным сопротивлением ламп, обеспечивать защиту от короткого замыкания.

Подсветка на CCFL лампах имеет более сложную схемотехнику и значительное энергопотребление. Таких недостатков лишена LED подсветка.

LED (Light Emitting Diode) или светодиод – это полупроводниковый прибор, преобразующий электрический ток непосредственно в световое излучение. Для «зажигания» светодиода используется низкое напряжение. Он имеет высокий КПД, большой срок службы, отсутствие ртути, отсутствие выгорания и широкий цветовой охват.

Внимание. В мониторе присутствует опасное для жизни напряжение, поэтому все, что дальше описано в статье, Вы делаете на свой страх и риск!

Будем менять подсветку в мониторе Samsung SyncMaster 2343NW на LED. ]]> Комплект подсветки ]]> , который будет использован для замены, состоит из двух линеек белых сверхярких светодиодов и DC драйвера, через который управляются светодиоды:

Драйвер светодиодов промаркирован как СA-155 Rev:02 и имеет следующие контакты

  • VIN – плюс питания DC 10-24V (красный провод)
  • ENA – отключение/включение подсветки 0 – 3,3V (желтый провод)
  • DIM – регулировка яркости светодиодов 0,8 – 2,5V (желтый провод)
  • GND – минус питания (черный провод)

Сердцем драйвера подсветки является специализированная микросхема DF6113 (8-pin SOP-8L). Хочу сразу обратить внимание, что максимальное напряжение питание микросхемы по даташиту 24V. При указанном значении на плате в 30V микросхема у Вас проработает недолго. Возможности микросхемы:

  • входное напряжение в диапазоне от 5 до 24V
  • плавный старт
  • регулировка яркости от 10% до 100%
  • защита от короткого замыкания и перенапряжения
  • контроль тока светодиодной линейки

Микросхема поддерживает три режима управления яркостью – раздельный, одним сигналом и смешанное управление. На модуле CA-155 реализовано инвертированное аналоговое управление яркостью. Размеры модуля 65мм x 20мм .

LED линейка имеет следующую маркировку CA-540-530MM-24W-96LED

Длинна LED линеек, которые я заказал, составляет 537мм, что с запасом хватает для 23″ монитора Samsung SyncMaster 2343NW.

Светодиодная линейка представляет из себя полоску текстолита, шириной 4мм, на которую напаяно 96 сверхярких светодиодов белого свечения SMD3528 размером 3.5 х 2.8 х 1.8 мм (Д x Ш x В). Светодиоды подключёны параллельно-последовательно группами по 3 шт. Напряжение питания группы 9,6V. При необходимости ленту можно укорачивать до нужной длинны, но сохраняя при этом кратность диодов равную трем.

Установка LED подсветки

Для установки LED подсветки нам необходим двухсторонний белый или прозрачный скотч. Ширина LED линейки такова, что она точно становится в паз, где раньше стояли лампы CCFL Предварительно нам необходимо обрезать LED линейку до необходимой длинны. В моем случае пришлось отрезать три крайних светодиода. После укорачивания LED линеек, повторно проверяем их в работе. Наклеиваем скотч на нижнюю сторону линейки и освободив вторую сторону скотча от пленки, вклеиваем LED линейки в пазы находящиеся сверху и снизу. Очень важно провода LED линейки вывести с той стороны, где они были выведены раньше.

Теперь можно положить белую отражающую пленку, рассеивающее оргстекло и проверить перед окончательной сборкой матрицы. Если все сделано правильно, Вы увидите однотонную яркую подсветку экрана. Дальше все собираем в обратном порядке, по инструкции описанной в первой части статьи.

Переходим к плате инвертора и делаем небольшую доработку. Для этого выпаиваем предохранитель F41, через который подается +16V на питание инвертора. В моем случае выпаян и трансформатор инвертора, из-за сгоревшей обмотки.

Разберемся с сигналами, которые нам необходимы для подключение DC драйвера к комбинированной плате.

Необходимые сигналы выделены прямоугольниками:

  • «Контакт 2» +16V плюс питания драйвера
  • «Контакт 3» GND минус питания драйвера
  • «Контакт 7» A-DIM регулировка яркости
  • «Контакт 8» ON/OFF включение/отключение подсветки

Давайте разберем почему A-DIM, а не B-DIM. Я экспериментировал с обоими сигналами. Отличие сигналов состоит в том, что первый используется для аналоговой регулировки яркости. Сигнал A-DIM формируется микропроцессором монитора и изменяет величину напряжения постоянного тока. Увеличение сигнала А-DIM приводит к увеличению напряжения обратной связи и наоборот. Правда при регулировке яркости с панели управления монитора, значение изменяется только в пределах от 1 до 10 единиц. Мне этого вполне достаточно.

Возможно кто-то захочет использовать ШИМ сигнал для регулировки яркости, тогда необходимо подключиться к «Контакту 1» B-DIM. Сигнал В-DIM представляет собой низкочастотные импульсы, следующий на определенной частоте. При регулировке яркости, ширина этих импульсов изменяется. Именно ширина этих импульсов определяет ширину «пачек» переменного тока. При подключении данного DC драйвера к B-DIM регулировка яркости инвертируется, т.е при увеличении значения от 0 до 100, величина яркости изменяется от 100 до 10. Это можно обойти, если DC драйвер доработать по ]]> этой схеме ]]> . На некоторых форумах пользователи жалуются, что с LED подсветкой глаза устают быстрее, т.к. у некоторых глаза чувствительны к мерцанию подсветки. Это сказывается ШИМ регулировка яркости, но и это можно исправить, если DC драйвер доработать по ]]> другой схеме ]]> .

Из всего вышесказанного я выбрал подключение к A-DIM без доработок. Пределы изменения регулировки яркости меня полностью устраивают.

Вернемся к подключению DC драйвера на комбинированную плату. Провода с разъемом, идущим в комплекте, довольно короткие, поэтому я вызвонил тестером дорожки на плате и подпаял провода к ближайшим участкам. Вот что у меня получилось:

Плату DC драйвера подсветки я расположил так, чтобы она находилась на основной плате инвертора и был свободный доступ к подключению светодиодных линеек. Саму плату драйвера я посадил на термоклей. Теперь можно проверять работу подсветки и собирать монитор. После сборки всех плат, подключение светодиодов получилось довольно удобным.

После окончательной сборки мне захотелось проверить потребление монитора на полной яркости. По паспортным данным потребление монитора Samsung SyncMaster 2343NW составляет 44Вт. После установки светодиодов потребление составило 23,8Вт, практически в два раза меньше!

После установки светодиодов монитор стал немного «зеленить», но это решается настройками каналов RGB в меню монитора или видеокарты. Яркости и контрастности достаточно, картинка получилась довольно сочная.

Подводим итоги

Минусы:

  • Немного смещен баланс белого в сторону зеленых тонов
  • Регулировка яркости с ШИМ может дать эффект мерцания
  • Минимальное потребление при использовании светодиодов
  • Достаточная яркость и контрастность экрана
  • Более простая схемотехника, чем у инвертора с CCFL лампами
  • Отсутствие высокого напряжения, нагреаа и выгорания как у CCFL ламп
  • Увеличенный срок службы, по сравнению с CCFL лампами

Стремительное развитие LED технологий позволило уменьшить габариты техники, улучшить их характеристики, а самое главное значительно снизить энергопотребление, что в наше время является одним из самых важных показателей.

LED контроллер Gold-09E (YGD-9E, CJY) | Модули для мониторов

Универсальный LED контроллер (Driver) Gold-9E (GYD-9E, YGD-9E, CJY-20H70), для LED подсветки LCD-панелей 19-24′

 

Возможно использовать с LED полосой 540-530MM-24W-96LED (540мм), или с полосой CA-520-510-21W-90LED (520мм) и другими подобными

Характеристики:

  • Размер 70 x 20 мм
  • Входное напряжение: 10V-30V
  • Выходное напряжение: 9 — 9.6V
Извините, на данный момент, этого товара нет в наличии на складе.

Выберите аналогичный товар как «LED контроллер Gold-09E (YGD-9E, CJY)». Рекомендуем начать просмор сайта с главной страницы сайта магазина Dalincom, или с начала каталога Микросхемы. Кроме того, мы стараемся как можно быстрее восполнять складской запас, ожидайте поступление.

Что еще купить вместе с LED контроллер Gold-09E (YGD-9E, CJY) ?

 

Огромное количество электронных компонентов и технической информации на сайте Dalincom, может затруднить Вам поиск и выбор требуемых дополнительных радиотоваров, радиодеталей, инструментов и тд. Следующую информационную таблицу мы подготовили для Вас, на основании выбора других наших покупателей.

 

Сопутствующие товары
Код Наименование Краткое описание Розн. цена

** более подробную информацию (фото, описание, маркировку, параметры, технические характеристики, и тд.) вы сможете найти перейдя по ссылке описания товара
5241 LED контроллер Gold-09E (YGD-9E, CJY) Универсальный LED контроллер (Driver) Gold-9E (GYD-9E, YGD-9E), для подсветки LCD-панелей 19-24′ 205 pyб.
5077 DC-DC преобразователь на LM2596S (1.25V~35V) Преобразователь напряжения (понижающий) на микросхеме LM2596S (1.25V~35V) с плавной регулировкой 78 pyб.
5677 14W-15F-66LED (336мм) Светодиодная полоса 114W-15F-66LED (336мм) для ЖК панелей с LED подсветкой 221 pyб.
8234 LED-3528 (3V, 1W, LG) Светодиод LED-3528, (полный партномер LATWT470RELZK), белый 12 pyб.
1658 Щупы для мультиметра (модель FC-136) Набор из двух прочных универсальных щупов для различных мультиметров (тестеров). Длина провода 1 метр. 127 pyб.
1734 Термоусадочная трубка, черная, 2 мм Термоусадочная трубка SALIPT диаметр 2.0 мм, цвет черный 10 pyб.
6248 DC-DC преобразователь на MP2307DN (Mini-360) Преобразователь напряжения (понижающий) на микросхеме MP2307DN с регулировкой 43 pyб.
2424 AS15-F Микросхемы AS15-F (TSL1014IF, SL1014I, HX8915-A) — IC Power Controller (14+1 Channel Voltage Buffers for TFT LCD) 65 pyб.
8744 LED контроллер Gold-08ES (AVT LED-12) Универсальный LED контроллер (Driver) AVT LED-12, для подсветки LCD-панелей 15-24′ 275 pyб.
2122 Припой SUOER 0.8мм, 100гр. Припой высокого качества SUOER с флюсом, Sn60Pb40, мягкий, в катушке, диаметр 0.8мм, вес 100 грамм 277 pyб.

 

ViewSonic VA2231WA-LED нет подсветки

 

Поступил в ремонт

ViewSonic VA2231WA-LED

с неисправностью «нет подсветки»

 

 

 

 

 

 

 

 

 

Состав монитора:
model no: vs13694
PSU: ILPI-268 rev:A
Main: ILIF-260 rev:B
инвертор ILL-071 Rev:A
Led driver: INL858RN

Управление подсветкой данной модели монитора реализовано драйвером INL858RN на отдельной плате ILL-071  смонтированой на блоке питания ILPI-268:

 Внешний вид mainboard:

Даташита на драйвер INL858RN найти не удалось. Удалось найти лишь распиновку с номиналами напряжений:

Распиновка INL858RN:

 

Диагностика показала неисправность светодиодов светодиодной ленты подсветки матрицы монитора.

Так как в продаже такую ленту найти не удалось принято решение о переделке подсветки на универсальную LED подсветку с заменой штатного инвертора  ILL-071 на инвертор GYD-9E:

 

Универсальный комплект светодиодных лент с инвертором в комплекте можно приобрести здесь:

 Данный комплект поставляется вместе с инвертором и шлейфом с разъемом под колодку, партиями по пять комплектов.

 

И так, приступим.

Первым делом выпаиваем плату ILL-071 с блока питания монитора, она нам больше не понадобиться.

На фото снятая плата инвертора вместе с штатной LED линейкой:

 

Пробуем включить монитор вообще без инвертора. А что нам мешает? Единственное не забываем подлючить к источнику сигнала VGA — к компьютеру, иначе данная модель монитора сразу после показа заставки уходит в дежурный режим при отсутствии сигнала VGA.

Монитор без инвертора чувствует себя прекрасно.

Рапиновка инвертора GYD-9E :

VIN — питание инвертора 10-30V

ENA -сигнал включения

DIM — регулировка яркости подсветки

GND -земля

 

Все необходимые напряжения и сигналы находяться на нашем блоке питания на местах пайки штаного ивертора:

 

Припаиваем провода нашего нового инвертора к блоку питания в соответствии с распиновкой (вид с верхней стороны платы):

Сигналы On\Off и регулировка уровня подсветки приходят по дорожкам с разъема CN801 соединенного с main платой монитора:

Теперь разбираем матрицу, если вы этого еще не сделали и убираем штатную светодиодную линейку. Маркировки толковой я на ней не обнаружил. Лишь только цифры: 200010 15-00. Поэтому вместо нее устанавливаем нашу универсальную планку и собираем матрицу обратно:

Далее соединяем планку подсветки с инвертором и проверяем работу  монитора в разобранном виде:

Плату инвертора можно закрепить вот таким образом на болт с гайкой под имеющееся на инверторе отверстие. На скотч крепить не рекомендую, потому как он имеет свойство высыхать со временем. Крепим как можно надежнее:

Все. Собираем монитор и радуемся. Подсветка работает отлично:

 

Материалы по переделке мониторов и телевизоров с ламп на светодиодную LED подсветку:

 

Samsung 2243NWX замена ламп подсветки на LED светодиодные ленты


Замена ламп подсветки на LED на примере монитора LG Flatron W2243S


Телевизор Rubin RL-22B05F нет подсветки. Переделка на LED

Написать комментарий:

Блоги на Эгее — Установка LED подсветки на монитор Samsung…

Введение

Всем привет.

И так, когда-то очень-очень давно, я покупал пару мониторов Samsung SyncMaster 943n. Мониторы мне эти очень нравились. Хорошее качество, приятная картинка, диагональ 19 дюймов (да-да, когда то это было достаточно круто). Но со временем, у них начали садиться лампы. Один из мониторов я благополучно продал, а другой остался у меня. В какой-то момент я заменил в нём лампы, но все, же около года назад, монитор стал выключать подсветку, сразу после включения.

Конечно, к тому времени необходимости в нём уже особой не было, в работе были уже мониторы 22 дюйма, а старичок остался на память. После года ожидания (всё никак не доходили руки починить), я всё же взялся за старый монитор т. к. мне потребовался какой-нибудь монитор, чтобы отправить его на ПМЖ в сад для родителей.

Так как менять лампы не целесообразно, в мониторе их аж 4, по 2 сверху и снизу, я решил поставить LED подсветку. Так сказать стильно, модно, современно. Да и по цене выходит даже дешевле.

Выбор пал вот на такой драйвер (GYD-9E) с двумя светодиодными планками.

Замена ламп

И так, приступим. Для начала, необходимо выполнить самую кропотливую, как я считаю работу — разобрать экран монитора и заменить старые лампы новыми светодиодными планками.

Далее, после полной разборки монитора, снимаем короба с лампами со стекла. Как видно по фото, у меня лампы вышли из строя из-за оплавления контактов.

Теперь, вынимаем старые лампы и очищаем металлические короба от мусора, остатков ламп и пр. Желательно немного обезжирить поверхность крепления диодных линеек. Я для этого использую изопропиловый спирт.

Далее потребуется подогнать размер линеек под короба. Увы, но подогнать именно ровно по длине не выйдет, т. к. диоды с линеек надо отрезать по 3 шт. Таким образом, примеряем линейки так, чтобы поместилось максимальное количество диодов, но при этом, отрезая от линейки их по 3 шт. Я отрезал по 6 диодов от каждой линейки, у меня вышло вот так.

Ну, а дальше всё обратном порядке. Собираем экран строго в обратной последовательности, внимательно все, проверяя на каждом этапе сборки, защёлкивая все клипсы и крепления, чтобы в дальнейшем не пришлось разбирать всё снова.

Установка драйвера

Ну вот, с экраном разобрались. Теперь займёмся платой монитора и драйвером управления.
Так как блок инвертора на плате нам больше не требуется, я частично демонтировал детали схемы инвертора, тем самым отключив сам инвертор и положив несколько деталей в закрома.

Как видно по фотографии, я снял трансформатор инвертора, выходные ёмкости, предохранитель и прочий мелкий обвес. Тут ничего сложного. Кому ничего этого не требуется, могут просто снять в данной цепи предохранитель и всё.

Теперь переходим к самому интересному — установке драйвера подсветки. При установке драйвера подсветки, основной особенностью работы самого драйвера является регулировка яркости нашей будущей подсветки. Есть несколько нюансов с инвертирование управления и пр. Расскажу несколько подробнее.

Канал регулировки драйвера подсветки можно подключить к одной из 2-х шин на блоке монитора: A-Dim или B-Dim. Отличие сигналов состоит в том, что первый используется для аналоговой регулировки яркости. Сигнал A-Dim формируется микропроцессором монитора и изменяет величину напряжения постоянного тока. Увеличение сигнала A-Dim приводит к увеличению напряжения обратной связи и наоборот. Правда при регулировке яркости с панели управления монитора, значение изменяется только в пределах от 1 до 10 единиц.

Если же вам регулировка по каналу A-Dim покажется недостаточно удобной, то вы можете воспользоваться каналом B-Dim, но тогда вам придётся модифицировать схему драйвера, т. к. при подключении к каналу B-Dim вы получите инвертированное управление. Т. е. при увеличении яркости в меню, подсветка будет становиться тусклее, а при уменьшении яркости — ярче. Если вам это не важно, или подсветка и так вас устраивает, то подключайте к шине A-Dim и не парьтесь. Я поступил именно так. Если изучить вопрос более детально, я рекомендую вам вот эту статью. Всё очень понятно и доходчиво написано, а так же имеются схемы модификации драйвера.

Осталось разобрать, что и куда подключать. У нас имеются следующие провода на драйвере:

  1. VIN  — плюс питания DC 10-24V (красный провод)
  2. ENA — отключение/включение подсветки 0 — 3,3V (желтый провод)
  3. DIM — регулировка яркости светодиодов 0,8 — 2,5V (желтый провод)
  4. GND — минус питания (черный провод)

Осталось определиться, куда припаять их на плате монитора.
Тут тоже всё достаточно просто. Внимательно смотрим на плату, там всё подписано. Таким образом, моя схема подключения драйвера выглядит вот так:

  1. VIN  — 2 контакт разъёма монитора.
  2. ENA — 8 контакт разъёма монитора.
  3. DIM — 7 контакт разъёма монитора.
  4. GND — 3 контакт разъёма монитора.

Собираем, проверяем. Всё работает.

Даже на полной яркости работа подсветки меня устраивает. Но работа по такому типу подключения накладывает ограничения, о которых я писал выше, при регулировке яркости, сила подсветки меняется только на первых 10 делениях. Т. е. в меню вся шкала составляет от 0 до 100, яркость изменяется только на этапе от 0 до 10, на этапе от 11 до 100 уже ничего не меняется, яркость находится в максимальном значении. Более понятно я думаю, станет, если вы сами поэкспериментируете и решите для себя, как вам больше подходит. Меня же устроил и такой вариант.

Источник: В наушниках по жизни — Установка LED подсветки на монитор Samsung SyncMaster 943n. Опубликовано с помощью IFTTT.

Схема монитора samsung 943n

Введение

И так, когда-то очень-очень давно, я покупал пару мониторов Samsung SyncMaster 943n. Мониторы мне эти очень нравились. Хорошее качество, приятная картинка, диагональ 19 дюймов (да-да, когда то это было достаточно круто). Но со временем, у них начали садиться лампы. Один из мониторов я благополучно продал, а другой остался у меня. В какой-то момент я заменил в нём лампы, но все, же около года назад, монитор стал выключать подсветку, сразу после включения.

Конечно, к тому времени необходимости в нём уже особой не было, в работе были уже мониторы 22 дюйма, а старичок остался на память. После года ожидания (всё никак не доходили руки починить), я всё же взялся за старый монитор т. к. мне потребовался какой-нибудь монитор, чтобы отправить его на ПМЖ в сад для родителей.

Так как менять лампы не целесообразно, в мониторе их аж 4, по 2 сверху и снизу, я решил поставить LED подсветку. Так сказать стильно, модно, современно. Да и по цене выходит даже дешевле.

Выбор пал вот на такой драйвер (GYD-9E) с двумя светодиодными планками.

Замена ламп

И так, приступим. Для начала, необходимо выполнить самую кропотливую, как я считаю работу — разобрать экран монитора и заменить старые лампы новыми светодиодными планками.

Далее, после полной разборки монитора, снимаем короба с лампами со стекла. Как видно по фото, у меня лампы вышли из строя из-за оплавления контактов.

Теперь, вынимаем старые лампы и очищаем металлические короба от мусора, остатков ламп и пр. Желательно немного обезжирить поверхность крепления диодных линеек. Я для этого использую изопропиловый спирт.

Далее потребуется подогнать размер линеек под короба. Увы, но подогнать именно ровно по длине не выйдет, т. к. диоды с линеек надо отрезать по 3 шт. Таким образом, примеряем линейки так, чтобы поместилось максимальное количество диодов, но при этом, отрезая от линейки их по 3 шт. Я отрезал по 6 диодов от каждой линейки, у меня вышло вот так.

Ну, а дальше всё обратном порядке. Собираем экран строго в обратной последовательности, внимательно все, проверяя на каждом этапе сборки, защёлкивая все клипсы и крепления, чтобы в дальнейшем не пришлось разбирать всё снова.

Установка драйвера

Ну вот, с экраном разобрались. Теперь займёмся платой монитора и драйвером управления.
Так как блок инвертора на плате нам больше не требуется, я частично демонтировал детали схемы инвертора, тем самым отключив сам инвертор и положив несколько деталей в закрома.

Как видно по фотографии, я снял трансформатор инвертора, выходные ёмкости, предохранитель и прочий мелкий обвес. Тут ничего сложного. Кому ничего этого не требуется, могут просто снять в данной цепи предохранитель и всё.

Теперь переходим к самому интересному — установке драйвера подсветки. При установке драйвера подсветки, основной особенностью работы самого драйвера является регулировка яркости нашей будущей подсветки. Есть несколько нюансов с инвертирование управления и пр. Расскажу несколько подробнее.

Канал регулировки драйвера подсветки можно подключить к одной из 2-х шин на блоке монитора: A-Dim или B-Dim. Отличие сигналов состоит в том, что первый используется для аналоговой регулировки яркости. Сигнал A-Dim формируется микропроцессором монитора и изменяет величину напряжения постоянного тока. Увеличение сигнала A-Dim приводит к увеличению напряжения обратной связи и наоборот. Правда при регулировке яркости с панели управления монитора, значение изменяется только в пределах от 1 до 10 единиц.

Если же вам регулировка по каналу A-Dim покажется недостаточно удобной, то вы можете воспользоваться каналом B-Dim, но тогда вам придётся модифицировать схему драйвера, т. к. при подключении к каналу B-Dim вы получите инвертированное управление. Т. е. при увеличении яркости в меню, подсветка будет становиться тусклее, а при уменьшении яркости — ярче. Если вам это не важно, или подсветка и так вас устраивает, то подключайте к шине A-Dim и не парьтесь. Я поступил именно так. Если изучить вопрос более детально, я рекомендую вам вот эту статью. Всё очень понятно и доходчиво написано, а так же имеются схемы модификации драйвера.

Осталось разобрать, что и куда подключать. У нас имеются следующие провода на драйвере:

  1. VIN — плюс питания DC 10-24V (красный провод)
  2. ENA — отключение/включение подсветки 0 — 3,3V (желтый провод)
  3. DIM — регулировка яркости светодиодов 0,8 — 2,5V (желтый провод)
  4. GND — минус питания (черный провод)

Осталось определиться, куда припаять их на плате монитора.
Тут тоже всё достаточно просто. Внимательно смотрим на плату, там всё подписано. Таким образом, моя схема подключения драйвера выглядит вот так:

  1. VIN2 контакт разъёма монитора.
  2. ENA8 контакт разъёма монитора.
  3. DIM7 контакт разъёма монитора.
  4. GND3 контакт разъёма монитора.

Собираем, проверяем. Всё работает.

Даже на полной яркости работа подсветки меня устраивает. Но работа по такому типу подключения накладывает ограничения, о которых я писал выше, при регулировке яркости, сила подсветки меняется только на первых 10 делениях. Т. е. в меню вся шкала составляет от 0 до 100, яркость изменяется только на этапе от 0 до 10, на этапе от 11 до 100 уже ничего не меняется, яркость находится в максимальном значении. Более понятно я думаю, станет, если вы сами поэкспериментируете и решите для себя, как вам больше подходит. Меня же устроил и такой вариант.

If you get stuck in repairing a defective appliance download this repair information for help. See below.
Good luck to the repair!

Please do not offer the downloaded file for sell only use it for personal usage!

  • If you have any question about repairing write your question to the Message board. For this no need registration.
  • Please take a look at the below related repair forum topics. May be help you to repair.

Warning!
If you are not familiar with electronics, do not attempt to repair!
You could suffer a fatal electrical shock! Instead, contact your nearest service center!

Источники питания и инверторы задней подсветки – это то, что вызывает повышенный интерес у специалистов по ремонту LCD-мониторов. И это вполне объяснимо, ведь данные модули дают наибольший процент отказов. Схемотехника этих модулей не является слишком уж сложной – опытный специалист вполне может разобраться в ней и без принципиальной схемы, а уж при наличии описания на элементную базу и подавно. Тем не менее, принципиальная схема на ремонтируемый узел еще никому и никогда не мешала. Таким образом, схема на блок питания и инвертор является самой ценной частью сервисных руководств. Но многие производители, и среди них Samsung, в своих руководствах по диагностике и ремонту мониторов крайне редко приводят эту, наиболее востребованную информацию, что в значительной степени затрудняет жизнь неавторизованных сервисов. Надеемся, что представленный здесь результат изучения инвертора монитора Samsung SyncMaster 943N, поможет вам в вашей работе.

Как и в большинстве современных мониторов, в Samsung SyncMaster 943N принята концепция, согласно которой в мониторе имеется две печатные платы: плата скалера/микропроцессора и комбинированная плата источников питания, на которой размещен источник питания монитора (Power Supply) и инвертор задней подсветки (Back Light Inverter).

В данном обзоре мы рассматриваем такую, достаточно известную, комбинированную плату инвертора и блока питания для мониторов семейства SyncMaster 943N,

Хотя мониторы этой модели могут оснащаться и другими типами комбинированной платы. Плата PWI1904SJ (она еще получила название McKinley 17″/19″ Normal) претерпела несколько модификаций (ревизий). Мы же рассмотрим плату версии 1.1 (Rev.1.1). Следует отметить, что номер этой платэ по каталогу Samsung – BN44-00123L.

Итак, как уже говорилось, плата состоит из двух, практически независимых, частей. Дадим краткую характеристику каждой из них.

Источник питания

Блок питания обеспечивает формирование двух выходных напряжений постоянного тока: +15В и +5В. Источник питания представляет собой классический однотактный импульсный преобразователь обратноходового типа. В качестве основного элемента этого источника можно выделить ШИМ-контроллер со встроенным силовым ключом – микросхему DM0456R. Именно эта микросхема и определяет схемотехнику всего источника, кстати сказать, очень простую (если не употребить слово примитивную).

Инвертор задней подсветки

Инвертор обеспечивает формирование высокочастотного переменного напряжения 650В на четырех лампах задней подсветки. Величина тока ламп находится на уровне 7.5 мА. В инверторе используется достаточно передовой вариант схемотехники – резонансный преобразователь. Инвертор поддерживает все основные варианты защиты (защиту от превышения напряжения, защиту от обрыва ламп), управление инвертором обеспечивает контроллер FAN7314 (см. предыдущую статью). В качестве питающего напряжения инвертора используется напряжение +15В.

Принципиальная схема платы

PWI1904SJ (М) Rev.1.1 представлена далее. Основные электрические характеристики платы (входные и выходные напряжения, мощность тока) указаны на самой плате. А мы переходим к детальному описанию основных элементов представленной схемы.

Источник питания

Источник питания, являясь импульсным, состоит из стандартного набора узлов, каждый из которых выполняет соответствующую функцию. Мы не будем давать детальное описание каждого узла, ведь, как уже говорилось выше, источник питания построен по классической схеме, а мы не ставим целью данного обзора изучение основ импульсных преобразователей. Остановимся на том, что сопоставим основные узлы источника питания и электронные элементы представленной схемы.

Входные цепи

Входным разъемом, на который подается переменное сетевое напряжение, является разъем IN101. Защита от превышения входного тока обеспечивается предохранителем F101 (3.15 Ампер).

Входной сетевой фильтр образован следующими элементами: конденсаторами Cx101, Сх102, Cx01, Сх02, резисторами R101, R102, R103, дросселем L101, термистором ТН101.

Выпрямление сетевого напряжения обеспечивается интегральным диодным мостом DB101, а сглаживание электролитическим конденсатором С101.

Импульсный преобразователь

Основным элементом преобразователя является ШИМ-контроллер со встроенным силовым ключом – интегральная 5-контактная микросхема на радиаторе, имеющая позиционное обозначение U101. В данной схеме используется очень популярная в последнее время микросхема – DM0465R. Обсуждать этот контроллер мы не будем, так как найти его описание не составляет труда.

Пусковая цепь ШИМ-контроллера DM0465R образована резисторами R104, R106, R106 сопротивлением по 24 кОм каждый.

Цепь питания ШИМ-контроллера DM0465R в установившемся режиме образована резистором R108, диодом D102, конденсаторами С104 и С105. Источником энергии для питания ШИМ-контроллера в рабочем режиме, является обмотка импульсного трансформатора TF101 (конт.1-конт.2). Ограничение питающего напряжения осуществляется стабилитроном ZD101.

Снаббер, обеспечивающий подавление резонансных выбросов напряжения в первичной обмотке импульсного трансформатора TF101 при переключении силового транзистора, состоит из диода D101, резистора R107 и конденсатора С102.

Сигнал обратной связи, позволяющий стабилизировать выходные напряжения источника питания, подается на конт.4 ШИМ-контроллера DM0465R. Величина сигнала обратной связи на конт.4 управляется оптроном РС101.

Вторичные выпрямители

Вторичные выпрямители выполнены по однополупериодной схеме.

Выпрямительные диоды каждого канала состоят из пары параллельно включенных диодов. Это позволяет увеличить токовую нагрузку каналов.

Сглаживание выпрямленных импульсов в канале +15В обеспечивается конденсатором С209 и конденсаторами С206, С207, С31, которые мы отнесли к схеме инвертора.

Сглаживание импульсов в канале +5В обеспечивается конденсаторами С201, С202, С203, а также дросселем L202.

Сигнал обратной связи для обеспечения стабилизации выходных напряжений формируется из напряжения канала +5В с помощью делителя R205/R20S. Полученное этим делителем напряжение, управляет микросхемой U201 типа TL431 (управляемый регулятор). Эта микросхема, в свою очередь, управляет током через светодиод оптрона РС101, что в итоге, изменяет величину сигнала обратной связи на конт.4 ШИМ-контроллера DM0465R.

Инвертор задней подсветки

Нагрузкой инвертора задней подсветки являются четыре лампы CCFL, подключенные к четырем разъемам: CN1, CN2, CN3, CN4. Высоковольтным трансформатором является Т1 с двумя первичными и двумя вторичными повышающими обмотками.

Инвертор выполнен по резонансной схеме. Резонансный контур образован первичными обмотками трансформатора Т1 и двумя параллельными SMD-конденсаторами: С32 и СЗЗ. Таким образом, резонансный контур является последовательным.

Питающим напряжением инвертора является +15В, которое подается на инвертор через предохранитель F201 (3 Ампер). Это напряжение используется и для питания управляющей микросхемы, и для питания силового каскада -резонансного контура.

Колебания в резонансном каскаде обеспечиваются синхронным переключением двух силовых транзисторов в интегральном исполнении (транзисторная сборка типа STU407DH). Транзисторы являются полевыми: один из них Р-канальный (верхний ключ), а другой N-каналъный (нижний ключ). Управление транзисторами осуществляет контроллер задней подсветки FAN7314.

Так как контроллер предназначен для управления мостовым преобразователем, а в данной схеме используется всего два транзистора, а не четыре, то два выхода (OUTC и OUTD) микросхемы не используются (конт.14 и конт.15). Противофазные импульсы формируются на выводах OUTA и OUTB (конт.18 и конт.19). Импульсы следуют с частотой в несколько десятков кГц (но последовательность импульсов прерывается, образуя, так называемые, «пачки» – см. ниже про регулировку яркости). Эта частота задается конденсаторами С5, С24, С25. В зависимости от модификации платы, конденсаторы С24 и С25 могут включаться в разных комбинациях. Для этих целей предусмотрены перемычки. Кроме того, частота внутреннего генератора задается еще и номиналом резистора R5.

Обратная связь по току Для стабилизации тока ламп, т.е. для стабилизации их яркости, в инверторах применяется отрицательная обратная связь по току. Для обеспечения обратной связи по току, последовательно с лампами включается токовой датчик – резистор, сопротивлением от нескольких сотен Ом до 1 кОм. Эти резисторы, традиционно, являются прецизионными (с допуском на отклонение номинала в 1%). С резистора обратной связи снимается напряжение, величина которого прямопропорпионально величине тока, протекающего через лампы, а, значит, пропорционально яркости лампы.

В представленной схеме такими токовыми датчиками являются R16, R17, R18, R19, номиналом по 1 кОм. Сигналы, снимаемые со всех четырех датчиков, сводятся в одну точку, в которой и образуется результирующее напряжение обратной связи. Суммирование сигналов токовых датчиков осуществляется посредством развязывающих диодов диодных сборок D6, D7, D8, D9. Результирующее напряжение обратной связи подается на конт.9 контроллера FAN7314 через цепь согласующих резисторов R15, R9, R8.

К сигналу обратной связи еще добавляется сигнал A-DIM, который является аналоговым сигналом регулировки яркости. Сигнал A-DIM формируется микропроцессором монитора и изменяет свою величину при пользовательской регулировке яркости. Сигнал представляет собой напряжение постоянного тока, увеличение сигнала А-DIM приводит к увеличению напряжения обратной связи, и, как следствие, к уменьшению тока ламп. И наоборот.

Зашита от превышения напряжения

Защита от превышения напряжения на лампах обеспечивается сигналом обратной связи по напряжению. К «горячему» контакту каждого разъема ламп подключен емкостной делитель напряжения (С8/С29, С7/С15, С9/ С30, С10/С14). В средней точке каждого делителя формируется переменное синусоидальное напряжение, пропорциональное напряжению на лампах. Далее все четыре напряжения выпрямляются и суммируются с помощью диодов, диодных сборок D3 и D4. Результирующее напряжение прикладывается к конт.2 (OLR) контроллера FAN7314. Сглаживание суммирующего напряжения обеспечивается конденсатором С16. За счет диодов D3 и D4 на контакте OLR устанавливается напряжение, являющееся максимальным из четырех сигналов обратной связи по напряжению. Другими словами, превышение напряжение на любой из четырех ламп приводит к срабатыванию данной защиты.

Защита от обрыва ламп

Обрыв цепи лампы является опаснейшей ситуацией для инвертора. Это становится причиной выхода из строя силовых ключей инвертора, т.к. инвертор, являющийся импульсным преобразователем, начинает работать в режиме холостого хода без нагрузки. Обрыв ламп в данной схеме, как впрочем, и в большинстве других, определяется по отсутствию напряжения на резисторах токового датчика лампы (R16…R19).

При протекании тока через лампы, на резисторах R16…R19, формируется напряжение, которое сглаживается конденсаторами С17, C16, C19, С20. В результате, на этих конденсаторах устанавливается напряжение, обеспечивающее запирание диодов диодных сборок D10 и D11. Закрытое состояние всех этих четырех диодов обеспечивает открытое состояние транзистора Q1, т.к. база этого транзистора смещена на величину опорного напряжения VREF, вырабатываемого контроллером FAN7314.

Если обрывается хотя бы одна лампа, то тут же открывается один из четырех диодов сборок D10 и D11, т.к. на стороне катода соответствующего диода пропадает запирающее напряжение. Это, в свою очередь, приводит к закрыванию транзистора Q1 и блокировке контроллера FAN7314.

Регулировка яркости

В рассматриваемом инверторе приме няется метод регулировки яркости Burst Dimming (метод прерывистой регулировки), предполагающий, что ток ламп представляет собой «пачки» высокочастотного переменного тока (рис.2). «Пачка» соответствует включенному состоянию лампы, а между пачкам, соответственно, лампа выключается. Ширина этих пачек, т.е. соотношение включенного и выключенного состояния ламп, определяет яркость заднейподсветки. При увеличении яркости, ширина «пачек» увеличивается, а при максимальном уровне яркости, ток в лампах становится, фактически, непрерывным.

Регулировка яркости в данной схеме осуществляется двумя сигналами: A-DIM и B-DIM, формируемыми микропроцессором монитора.

Сигнал B-DIM подается на вход инвертора через конт.1 разъема CN201. Сигнал В-DIM представляет собой низкочастотные импульсы, следующие с частотой примерно 200 Гц. При регулировке яркости, ширина этих импульсов изменяется. Именно ширина этих импульсов определяет ширину «пачек» переменного тока в лампах.

Сигнал A-DIM подается на вход инвертора через конт.7 разъема CN201, и представляет собой напряжение постоянного тока. Этот сигнал подмешивается к сигналу обратной связи, подаваемому на конт.9 микросхемы FAN7314. При регулировках яркости, сигнал A-DIM, практически, не изменяется. Значительное скачкообразное изменение уровня сигнала A-DIM происходит при изменении цветовой палитры через меню Magic Bright, и только при выборе некоторых установок этого меню.

Неисправности инвертора

Для инверторов семейства PWI1904SJ(M) характерны две неисправности:

выход из строя транзисторной сборки STU407DH;

выход из строя трансформатора Т1.

Отказы других элементов схемы являются крайне маловероятными, поэтому говорить о них не имеет смысла, а вот обсудить наиболее вероятные отказы необходимо.

Транзисторная сборка Сборка STU407DH представляет собой пару полевых транзисторов разной проводимости: N-канальный и Р-канальный. Внутренняя архитектура сборки и ее внешний вид представлены на рис.3.

Основные электрические характеристики транзисторов сборки следующие:

напряжение сток-исток: 40В;

напряжение затвор-исток: 20В;

ток стока (для Р-канального): -12А;

ток стока (для N-канального): 16А;

ток стока импульсный: 50А;

прямой ток демпферного диода (для Р-канального транзистора): -6А;

прямой ток демпферного диода (для N-канального транзистора): 8А;

Неисправность сборки заключается в пробое одного или двух транзисторов сборки. Диагностика сборки, естественно, проводится тестером (омметром), и заключается в поочередной проверке двух полевых транзисторов (как проверять полевые транзисторы мы здесь распространяться не будем). Следует также отметить, что аналоги этой транзисторной сборки не известны, поэтому при отказе STU407DH придется приобретать именно ее.

Трансформатор

Тип используемого в данном инверторе трансформатора – TMS92515CT.

Типовая неисправность данного трансформатора заключается в обрыве (или в «подгорании», т.е. в увеличении активного сопротивления) одной из двух вторичных высоковольтных обмоток.

Параметры этих вторичных обмоток исправного трансформатора следующие:

активное сопротивление: 1120…1130 Ом;

индуктивность : 1.93…1.95 Гн.

Исходя из представленных данных. Можно сказать, что диагностика трансформатора – дело весьма посредственное, осуществимое с помощью самого простого тестера. Достаточно лишь измерить сопротивление вторичных высоковольтных обмоток. Но хотелось бы отметить, что значение сопротивления обмотки может быть и другим, поэтому при проверке трансформатора лучше сравнить сопротивление его двух высоковольтных обмоток. Если сопротивления одинаковы, то трансформатор исправен. А если сопротивления различаются на 100 Ом и более, то можно говорить о неисправности трансформатора, причем неисправной обмоткой следует считать ту, у которой сопротивление больше.

Что же делать, если одна из обмоток в обрыве, или ее сопротивление увеличилось ?

Первое решение. Самым простым решением является замена трансформатора. Его приобретение в настоящий момент времени не должно составить особого труда. На рынке широко представлены «совместимые» трансформаторы с аналогичными характеристиками. Однако, следует иметь в виду, что при покупке «совместимого» трансформатора вполне можно столкнуться с ситуацией, когда при замененном трансформаторе инвертор не работает совсем, или через некоторое время срабатывает зашита.

Второе решение. Другим решением проблемы неисправного трансформатора является переделка схемы инвертора на работу с двумя лампами.

Для этого придется проделать следующее:

удалить неисправную высоковольтную обмотку;

заблокировать защиту от обрыва ламп;

выпаять резистор R31.

Неисправную обмотку придется полностью удалить (рис.4). Отключение нагрузки с неисправной обмотки (т.е. двух ламп), результата не дает, и при работе на холостом ходу (при заблокированной защите) трансформатор очень сильно нагревается. Защита от обрыва ламп, как указывалось ранее, организована посредством двух диодных сборок: D10 и D11. Поэтому блокировка защиты предполагает выпаивание одной диодной сборки, соответствующей тому «плечу» инвертора, в котором была удалена высоковольтная обмотка. Далее для надежности запуска инвертора, удаляем из схемы резистор R31.

После этого схему можно запускать, и к оставшейся обмотке нужно подключить две лампы. Для обеспечения равномерности засветки экрана, желательно сделать так, чтобы к оставшейся обмотке была подключена одна верхняя лампа и одна нижняя. Длина соединительных проводов ламп в мониторах с инвертором PWI1904SJ(M), позволяет проделать такую коммутацию без проблем.

Добавить комментарий

Отменить ответ

Для отправки комментария вам необходимо авторизоваться.

Прибыл светодиодный комплект

— Блог Ронокса

Мне придется подтвердить это, проверив спецификации компонентов, перечислив описание и затем фактически запустив его при 24 В, чтобы увидеть, может ли он напрямую работать от 24 В вместо обычных 12 В, убедитесь, что драйвер не перегревается, даже если он соответствует спецификации.

Если это сработает, у меня впереди несколько проблем; Во-первых, хрупкую и крошечную светодиодную ленту необходимо правильно установить в отражающий экран / корпус для световых трубок. По всей вероятности, я могу, вероятно, протереть его и любой конец и пропустить через него небольшой провод, чтобы зафиксировать его, плюс приклеить полосу к задней части отражателя с помощью термопасты.

Во-вторых, входящие в комплект провода стандартные, но не для 12 В, я раньше покупал ряд проводов и разъемов для общего пользования, и у меня есть стандартный размер, такой же, как у литиевых батарей для радиоуправляемых устройств, зажигалка в любом случае, или, по крайней мере, для отдельного зарядного кабеля (у некоторых есть вывод, ведущий к отдельным ячейкам для зарядки, но два сверхмощных разъема для последовательного выхода)

Если бы на мониторе было 12 В, а не 24 В, я думаю, что использовались бы эти разъемы, все они довольно стандартные, и раньше они имели дело с той же несовместимостью.

В-третьих, мне нужно протестировать светодиоды на 24 В, если они действительно предназначены для работы от 24 В, в последний раз я проверял, что они должны быть в порядке до 30 В, но, я должен быть уверен, так что я поработаю немного и посмотрим, как это справляется с теплом.

Я нахожу довольно подозрительным то, что на светодиодных лентах есть высоковольтные разъемы, которые идентичны тем, которые используются в лампах для подключения к инвертору. Могу поспорить, что многие случайно просто подключили их напрямую и сожгли, и, вероятно, повредили и монитор.

По неизвестным причинам красный и черный провода не являются положительными и отрицательными соответственно, они наоборот, и это не похоже на разовую ошибку, фотография в листинге показывает то же самое, поэтому не портите их.

Я проведу еще тесты, но сейчас похоже, что светодиоды примерно 9,6 В, а для драйвера требуется 2 входа, помимо питания, сигнала и входа ШИМ, но он будет нормально работать без ШИМ, насколько я могу судить, это будет работать на максимальной мощности, если не указано иное, что хорошо, если монитор не может синхронизироваться с драйвером.Для целей тестирования при 12 В и 24 В должно хватить резистора 5 кОм между питанием и сигналом питания (ENA), я думаю, что обычно этот вывод предназначен для 5 В. и 5 кОм должны поддерживать ток ниже 10 мА, безопасный уровень сигнала. Я не думаю, что это действительно нужно, учитывая, насколько он невосприимчив к обрыву сигнала.

Теперь я собираюсь пойти и сравнить яркость инверторных ламп с новыми светодиодами, чтобы выяснить, нужно ли мне вообще настраивать питание, потому что разобрать монитор — проблема, и, честно говоря, я мог бы просто решить рискнуть и включите сок, не проверяя, могут ли светодиоды справиться с дополнительным тепловыделением.

-редактировать-

После небольшого тестирования я обнаружил, что драйвер GYD-9E перегревается при 24 В, я не думаю, что он стабилен выше 12 В.
Также драйвер обычно потребляет около 700-800 мА в любое время, независимо от входного напряжения, без изменений на выходе. Я буду использовать регулятор с подходящим радиатором для питания драйвера светодиода. Хотя я думаю, что его достаточно для этих светодиодных лент, я не думаю, что ему можно доверять выше 15 В.

Просмотры сообщений: 2,123

Placa Circuito Impreso Led | MercadoLibre.com.ar

101 resultados

Категории
Componentes Electrónicos (85)
Аксессуары для транспортных средств (11)
Computación (3)
Celulares y Teléfonos (1)
1
Otros y Teléfonos (1)
1
)
Costo de envío
Gratis (29)
Tiempo de entrega
Llegan en menos de 24 hs (40)
Tipo de entrega
Con envío (99)
Pago
Sin interés (17)
Condición
Nuevo (100)
Usado (1)
Ubicación
Capital Federal (74)
Córdoba (8)
Bs.В качестве. G.B.A. Sur (7)
Санта-Фе (7)
Bs.As. G.B.A. Oeste (3)
Bs.As. G.B.A. Norte (1)
La Pampa (1)
Precio
Hasta 500 долл. (32)
500 долл. США (34)
Más от 2,500 долл. США (35)
Подробные сведения об общедоступной информации
Mejores vendedores (68)
  1. 648 песо с 01 сентаво $ 648,01

  2. 277 песо с 75 сентаво $ 277,75

  3. 500 песо с 49 сентаво $ 500,49

  4. 500 песо с 50 сентаво $ 500,50

  5. Hasta 6 cuotas sin interés
  6. interés
  7. 173 песо с 07 сентаво $ 173,07

    Hasta 6 cuotas sin interés
  8. Hasta 6 cuotas sin interés
  9. 333 песо с 41 сентаво $ 333,41

  10. Hasta 6 cuotas sin interés
  11. 183 песо с 70 сентаво $ 183,70

    Hasta 6 cuotas
  12. с 70 сентаво $ 183,70

    Hasta 6 cuotas sin interés
  13. 156 песо с 80 сентаво $ 156,80

  14. 156 песо с 80 сентаво $ 156,80

  15. песо

    57 50

    Hasta 6 cuotas sin interés
  16. Hasta 6 cuotas sin interés
  17. 477 песо с 50 сентаво $ 477,50

  18. El envío gratis está sujeto al peso, Precio y la distancia del envío.

    Huawei Enjoy 9e Лучшая цена в Гайане 2021, характеристики, обзоры и изображения

    Лучшая доступная цена на Huawei Enjoy 9e в Гайане составляет 0 / — GYD , и в настоящее время она доступна в нескольких интернет-магазинах в Гайана, , а также в Джорджтауне и Джорджтауне вместе с полной гарантией в соответствии с политикой магазина.

    Huawei Enjoy 9e Цена в Гайане и доступных странах

    Магазин
    Страна Цена Цена — GYD
    Гайана 0 / — GYD

    Huawei Enjoy 9e Цена и характеристики в Гайане

    Имя Huawei Наслаждайтесь 9e
    Новая цена GYD.0 / — Примерно
    Б / у Цена GYD. 0 / — Примерно
    Дата выпуска Выпущено 2019, апрель
    Технические характеристики 6,09 Дисплей, 3 ГБ ОЗУ, 32 ГБ / 64 ГБ памяти, слот для карт памяти microSD, камера 13 МП, аккумулятор 3020 мАч.
    Варианты 32 ГБ / 64 ГБ памяти, слот microSD







    Huawei Enjoy 9e Цена в магазинах Гайаны


    Характеристики

    Huawei Enjoy 9e.

    Huawei Enjoy 9e выпущен в апреле 2019 года с привлекательными характеристиками: 150 г, толщина 8 мм , операционная система Super Performance Android 9.0; EMUI 9 и Heavy Storage 32 ГБ / 64 ГБ, слот microSD .
    Huawei Enjoy 9e — потрясающий выбор в аналогичной категории мобильных телефонов с 3 ГБ RAM вместе с 32 ГБ / 64 ГБ памяти, слотом microSD встроенным хранилищем с дополнительной мощностью 13MP Excellent Camera и 6.09 «Super Display Size Screen с аккумулятором емкостью 3020 мАч .

    Выпущено 2019, апрель 150 г, толщина 8 мм; Android 9.0; EMUI 9; 32 ГБ / 64 ГБ памяти, слот microSD
    Размер экрана

    6,09 дюйма

    Камера

    13 МП

    Барабан

    3 ГБ RAM

    Аккумулятор

    3020 мАч


    Удивительные скидки и предложения на мобильные аксессуары Huawei Enjoy 9e.


    Альтернативные мобильные телефоны Huawei Enjoy 9e

    BLU G80
    Дисплей 6,5 дюйма, камера 13 МП,
    3 ГБ ОЗУ и батарея 4000 мАч.
    Посмотреть цену
    BLU G60
    Дисплей 6,1 «, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор 4000 мАч.
    Посмотреть цену
    Realme Narzo 10A
    6.5-дюймовый дисплей, камера 12 МП,
    3 ГБ ОЗУ и аккумулятор 5000 мАч.
    Стандартная цена
    Realme C2s
    Дисплей 6,1 «, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор 4000 мАч.
    Посмотреть цену
    Infinix Hot 9 Play
    Дисплей 6,82 дюйма, камера 13 МП,
    3 ГБ ОЗУ и батарея 6000 мАч.
    Стандартная цена
    Оппо A12e
    6.2-дюймовый дисплей, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор 4230 мАч.
    Стандартная цена
    Amazon Fire HD 8 Plus 2020
    8,0-дюймовый дисплей, 2-мегапиксельная камера,
    3 ГБ ОЗУ и аккумулятор.
    Посмотреть цену
    Xiaomi Redmi 8A Pro
    6,22-дюймовый дисплей, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор на 5000 мАч.
    Посмотреть цену
    Xiaomi Redmi 8A Dual
    6.22-дюймовый дисплей, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор 5000 мАч.
    Стандартная цена
    Lenovo M10 FHD REL
    10,1-дюймовый дисплей, 8-мегапиксельная камера,
    3 ГБ ОЗУ и аккумулятор 7000 мАч.
    Посмотреть цену

    Huawei Enjoy 9e альтернативные мобильные телефоны Huawei


    Huawei Enjoy 9e Рейтинг производительности

    Дисплей

    7 из 10

    Камера

    6 из 10

    Память

    4 из 10

    Аккумулятор

    6 из 10


    Общий рейтинг производительности Huawei Enjoy 9e равен 5.75 из 10

    5,75


    Сравнение Huawei Enjoy 9e с другими мобильными телефонами

    Посмотреть Характеристики
    Huawei Enjoy 9e
    Дисплей 6,09 дюйма, камера 13 МП,
    3 ГБ ОЗУ и аккумулятор 3020 мАч.
    Цена: 0 / — GYD
    Против.

    Huawei Enjoy 9e Удивительные функции с советами и хитростями


    Huawei Enjoy 9e Расширенные характеристики.

    Huawei Enjoy 9e Выпущено в апреле 2019 г. с расширенными функциями: 150 г, толщина 8 мм, Android 9.0; ОС EMUI 9 с повышенной производительностью; Графический удобный интерфейс, объемная память с объемом памяти 32/64 ГБ, слот для карт памяти microSD. Huawei Enjoy 9e — лучший выбор в той же группе, что и мобильные телефоны с 3 ГБ оперативной памяти, 32 ГБ / 64 ГБ памяти, слотом microSD с 13 дополнительными мегапикселями, камерой с питанием и экраном 6,09 дюйма с емкостью 3020 мАч и тяжелой батареей.


    Плюсы и минусы Huawei Enjoy 9e

    Huawei Enjoy 9e Плюсы:

    • Smart Size 150 г, толщина 8 мм
    • ОС: Android 9.0; EMUI 9
    • Большой мобильный экран размером 6,09 дюйма
    • Дополнительная встроенная память 32 ГБ / 64 ГБ, слот microSD
    • Камера высокого разрешения 13 МП

    Huawei Enjoy 9e Минусы:

    • ОЗУ с низкой / средней скоростью ОЗУ 3 ГБ
    • Батарея с низкой / средней производительностью и емкостью 3020 мАч

    Часто задаваемые вопросы о Huawei Enjoy 9e


    • Когда выйдет Huawei Enjoy 9e?
    • Ответ: выпущено 2019, апрель

    • Доступен ли Huawei Enjoy 9e в Гайане?
    • Ответ: Да, это доступно в Гайане.

    • Сколько стоит Huawei Enjoy 9e в Гайане?
    • Ответ: Самая низкая цена в Гайане составляет 0 / — GYD.

    • Где я могу получить самую низкую цену на Huawei Enjoy 9e в Гайане?
    • Ответ: Самую дешевую цену на мобильный телефон можно найти на Mymobilemarket-Guyana

    • Какая страна Huawei Enjoy 9e самая дешевая в мире?
    • Ответ: Найдите самую дешевую цену на телефон Huawei Enjoy 9e в мире в сети Mymobilemarket.

    • Какой размер экрана у Huawei Enjoy 9e?
    • Ответ: Размер экрана 6,09 «.

    • Какая камера есть в Huawei Enjoy 9e?
    • Ответ: Мощность камеры 13 МП.

    • Что такое баран в Huawei Enjoy 9e?
    • Ответ: Объем оперативной памяти 3 ГБ.

    • Сколько стоит емкость хранилища в Huawei Enjoy 9e?
    • Ответ: Доступное хранилище: 32/64 ГБ, слот microSD.

    • Какие варианты хранения доступны в Huawei Enjoy 9e?
    • Ответ: Доступен с объемом памяти 32/64 ГБ, варианты с разъемом microSD.

    • Какая батарея стоит в Huawei Enjoy 9e?
    • Ответ: Емкость аккумулятора 3020 мАч

    • Какое время зарядки аккумулятора Huawei Enjoy 9e?
    • Ответ: Время работы от аккумулятора соответствует емкости аккумулятора 3020 мАч и мобильному использованию.

    • Какая операционная система используется в Huawei Enjoy 9e?
    • Ответ: ОС — Android 9.0; EMUI 9

    • Какая SIM-карта у Huawei Enjoy 9e: одинарная или двойная?
    • Ответ: У него

    • Сколько стоит процессор в Huawei Enjoy 9e?
    • Ответ: Huawei Enjoy 9e имеют следующий процессор;

    • Какие цвета доступны в Huawei Enjoy 9e?
    • Ответ: Доступен в цветах.

    • Huawei Enjoy 9e — хороший телефон?
    • Ответ: Да, это один из хороших вариантов в той же категории мобильных телефонов.

    • Huawei Enjoy 9e лучше других мобильных телефонов?
    • Ответ: Да, это лучший выбор, однако здесь вы можете сравнить другие доступные варианты.

    • Водонепроницаемый ли Huawei Enjoy 9e?
    • Ответ: Нет, не водонепроницаем.

    • Что лучше Huawei Enjoy 9e или других мобильных телефонов?
    • Ответ: Это телефон получше, да и другие доступные варианты тоже немалые.

    • Есть ли у Huawei Enjoy 9e отпечаток пальца?
    • Ответ: Huawei Enjoy 9e имеет следующие доступные датчики;

    • В чем разница между Huawei Enjoy 9e и другими мобильными телефонами?
    • Ответ: Huawei Enjoy 9e хорош по качеству сборки, при этом вы можете сравнить характеристики с другими доступными вариантами.

    Huawei Enjoy 9e Обзоры — Видео

    Checkout Распаковка и подробный видеообзор Huawei Enjoy 9e о внешнем виде, удивительных функциях и характеристиках.


    Руководство Mymobilemarket


    • Mobile Price Дата последней проверки 2021-09-03 19:21:52
    • Mymobilemarket Guyana не гарантирует доступность выбранной мобильной цены.
    • Цена для мобильных телефонов в магазинах в Гайане указана в GYD (местной валюте Гайаны).
    • Mymobilemarket Guyana не несет ответственности за мобильные телефоны, продаваемые в любом магазине в Гайане.
    • Выбранная цена для мобильных телефонов
    • действительна для всей Гайаны, включая Джорджтаун и Джорджтаун. .
    • Если выбран вариант Мобильный — это не ваш выбор, воспользуйтесь поиском Mymobilemarket Guyana , чтобы выбрать подходящий для вас мобильный телефон.
    • Перед новой покупкой убедитесь, что выбранные условия доставки мобильного телефона, возврата и гарантии в соответствующих магазинах Гайаны.
    • Если у вас возникла неточная информация о выбранном мобильном телефоне, пожалуйста, немедленно сообщите о [адрес электронной почты защищен] для исправления.
    • Все цены на мобильные телефоны регулярно менялись. Пожалуйста, регулярно посещайте Mymobilemarket Guyana , чтобы узнать о последних самых низких ценах на выбранные мобильные телефоны.
    • Mymobilemarket Гайана поможет зрителям получить самую низкую цену на выбранный мобильный телефон в различных магазинах Гайана, Великобритания, США, ОАЭ и во всем мире .
    • Выбранная цена для мобильных устройств в Mymobilemarket Guyana регулярно обновляется в соответствии с ценами в местных магазинах, но Mymobilemarket не может гарантировать точность выбранной мобильной цены.

    Huawei Enjoy 9e — Быстрый просмотр


    Лучшее мобильное производство в Гайане

    Мобильные телефоны Alcatel
    Мобильные телефоны Apple
    Мобильные телефоны Asus
    Мобильные телефоны BLU
    Мобильные телефоны Google
    Мобильные телефоны Huawei
    Мобильные телефоны Infinix
    Мобильные телефоны Motorola
    Motorola Мобильные телефоны
    Мобильные телефоны OnePlus
    Мобильные телефоны Oppo
    Мобильные телефоны Realme
    Мобильные телефоны Samsung
    Мобильные телефоны Vivo
    Мобильные телефоны Xiaomi
    Мобильные телефоны ZTE Мобильные телефоны ZTE

    Самые продаваемые мобильные телефоны в Гайане


    • Xiaomi Redmi Note 8 2021 | 6.3 дюйма | 48 МП | 4 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10S | 6,43 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 Pro Max | 6,67 дюйма | 108 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 Pro (Индия) | 6,67 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 Pro (Китай) | 6,6 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 Pro | 6.67 дюймов | 108 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 5G | 6,5 дюйма | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi Note 10 | 6,43 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi K40 Pro + | 6,67 дюйма | 108 МП | 12 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi K40 Pro | 6,67 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Игровой Xiaomi Redmi K40 | 6,67 дюйма | 64 МП | 12 ГБ ОЗУ | Посмотреть цену.

    • Xiaomi Redmi K40 | 6,67 дюйма | 48 МП | 12 ГБ ОЗУ | См. Цену

    • Xiaomi Poco X3 Pro | 6,67 дюйма | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Poco M3 Pro 5G | 6,5 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Xiaomi Poco M2 Reloaded | 6,53 дюйма | 13 МП | 4 ГБ ОЗУ | См. Цену

    • Xiaomi Poco F3 | 6,67 дюйма | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Часы Xiaomi Mi Revolve Active | 1.39 «| | 0 | См. Цену

    • Xiaomi Mi Mix Fold | 8,01 дюйма | 108 МП | 16 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11X Pro | 6,67 дюйма | 108 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11X | 6,67 дюйма | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11i | 6,67 дюйма | 108 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11 Ultra | 6,81 дюйма | 50 МП | 12 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11 Pro | 6.81 дюйм | 50 МП | 12 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11 Lite 5G | 6,55 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11 Lite | 6,55 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 10S | 6,67 дюйма | 108 МП | 12 ГБ ОЗУ | См. Цену

    • Xiaomi Черная акула 4 Pro | 6,67 дюйма | 64 МП | 16 ГБ ОЗУ | См. Цену

    • Xiaomi Черная акула 4 | 6,67 дюйма | 48 МП | 12 ГБ ОЗУ | Посмотреть цену.

    • Samsung Galaxy Xcover 5 | 5,3 дюйма | 16 МП | 4 ГБ ОЗУ | См. Цену

    • Samsung Galaxy Tab S7 FE | 12,4 дюйма | 8 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy Tab A7 Lite | 8,7 дюйма | 8 МП | 4 ГБ ОЗУ | См. Цену

    • Samsung Galaxy Quantum 2 | 6,7 дюйма | 64 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M62 | 6,7 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M42 5G | 6.6 дюймов | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M32 | 6,4 дюйма | 64 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M12 (Индия) | 6,5 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy F52 5G | 6,6 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy F22 | 6,4 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy F12 | 6,5 дюйма | 48 МП | 4 ГБ ОЗУ | Посмотреть цену.

    • Samsung Galaxy F02s | 6,5 дюйма | 13 МП | 4 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A72 | 6,7 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A52 5G | 6.5 дюймов | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A52 | 6.5 дюймов | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A32 | 6,4 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A22 5G | 6.6 дюймов | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A22 | 6,4 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Apple iPad Pro 12.9 (2021 г.) | 12,9 дюйма | 12 МП | 16 ГБ ОЗУ | См. Цену

    • Apple iPad Pro 11 (2021 г.) | 11,0 дюйма | 12 МП | 16 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A02s | 6,5 дюйма | 13 МП | 4 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A02 | 6,5 дюйма | 13 МП | 3 ГБ ОЗУ | Посмотреть цену.

    • Samsung Galaxy M02 | 6,5 дюйма | 13 МП | 3 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M02s | 6,5 дюйма | 13 МП | 4 ГБ ОЗУ | См. Цену

    • Samsung Galaxy A32 5G | 6,5 дюйма | 48 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy S21 5G | 6,2 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy S21 + 5G | 6,7 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Samsung Galaxy S21 Ультра 5G | 6.8 дюймов | 108 МП | 16 ГБ ОЗУ | См. Цену

    • Samsung Galaxy M12 | 6,5 дюйма | 48 МП | 6 ГБ ОЗУ | См. Цену

    • Samsung Galaxy F62 | 6,7 дюйма | 64 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Mi 11 | 6,81 дюйма | 108 МП | 12 ГБ ОЗУ | Посмотреть цену

    • Xiaomi Mi 10i 5G | 6,67 дюйма | 108 МП | 8 ГБ ОЗУ | См. Цену

    • Xiaomi Redmi 9T | 6,53 дюйма | 48 МП | 6 ГБ ОЗУ | Посмотреть цену.

    • Xiaomi Redmi Note 9T | 6,53 дюйма | 48 МП | 4 ГБ ОЗУ | См. Цену

    4821 E Nasa Parkway 9E, Сибрук, Техас 77586

    Замечательное роскошное высотное здание на берегу Чистого озера. Курортный образ жизни с круглосуточными услугами консьержа и камердинера. Из этого номера с 2 спальнями и 2 ванными комнатами открывается вид на озеро Чистое, залив Галвестон, Сибрук и Кемах. Вам понравится открытая равнина пола. На кухне есть гранитные столешницы, газовая плита и духовка Wolf, холодильник Sub Zero и многое другое.Наслаждайтесь всеми удобствами, такими как пейзажный бассейн, бесплатные лодки, театральный зал, гидромассажная ванна, кабинки для переодевания, фитнес-центр, зона для выгула собак и многое другое. Позвоните сегодня, чтобы увидеть этот красивый агрегат.

    Продано Диапазон цен:

    420 001–482 000 долл. США

    Адрес:

    4821 E Nasa Parkway 9E

    Юридическое описание:

    БЛОК 9Е ЭТАЖ 9.0105 INT COMMON LAND & ELE ENDEAVOR CONDO

    Тип недвижимости:

    Кондоминиум средней / высокой высотой

    Год постройки:

    2006 / Оценочный округ

    пл .:

    1,702158 (м²) / Оценочный район

    Комиссия за обслуживание:

    $ 1131 / в месяц

    Комнат / Лот Размеры

    Описание номера:

    1 гостиная, совмещенная гостиная / столовая, подсобное помещение в доме,

    Описание номера:

    1 гостиная, совмещенная гостиная / столовая, подсобное помещение в доме,

    Элементы интерьера

    Камин:

    1 / Камин газовый

    Этажей:

    Ковер, паркет, плитка

    Кухня Описание:

    Барная стойка, Кухня, открытая для Семейного номера, Ящики для кастрюль / сковородок, Ящики с мягким закрыванием, Освещение шкафа

    Описание спальни:

    Все спальни сняты

    Описание ванной комнаты:

    Доступ для инвалидов, двойные раковины, основная ванна + отдельный душ, джакузи / гидромассажная ванна

    Отопление:

    Центральный электрический, тепловой насос

    Охлаждение:

    Центральная электрическая

    Духовка:

    Конвекционная печь, газовая печь

    Приборов:

    Сушильная машина в комплекте, полноразмерная, холодильник, многоуровневая, стиральная машина в комплекте

    Энергетическая характеристика:

    Потолочные вентиляторы, изолированные двери, изолированные окна / окна с низким энергопотреблением

    Интерьер:

    Балкон, бетонные стены, шторы / занавески / оконное покрытие, лифт, пожарная / дымовая сигнализация, полностью орошение, подъезд под давлением, холодильник в комплекте

    Внешний вид

    Удобства для воды:

    Переборка, вид на озеро, набережная, пирс

    Описание лота:

    Вид на воду, набережная

    Парковка:

    Обозначенная парковка, контролируемый въезд, услуга парковщика

    Контролируемый доступ:

    Доступ по карте / коду, регистратор

    Просмотры:

    Восток, Север, Юг, Запад

    Расположение объекта:

    Вид на воду, набережная

    Внешний вид:

    Балкон / терраса, сухая сауна, тренажерный зал, комната для вечеринок, игровая зона, спа, мусоропровод

    Дополнительная информация

    Тип списка:

    Исключительное право продажи / аренды

    Management Co, место нахождения:

    Есть

    Финансовая информация

    Рассмотрено финансирование:

    Продажа за наличные, обычная

    Прочие комиссии:

    Да / 2262 / Взнос в резерв

    Комиссия за обслуживание:

    Да / 1131 $ / В месяц

    Комиссия за обслуживание

    включает:

    Здание и территория, консьерж, газ, страхование, зона общего пользования, ограниченный доступ, места отдыха, вывоз мусора, парковка служащим, вода и канализация

    Налоги без освобождения:

    $ 12, 040/2019

    Поиск белков человека с помощью 12548788

    Поиск белков человека с помощью 12548788

    BLASTP 2.2.11 [июн-05-2005]
    
    
    Ссылка: Альтшул, Стивен Ф., Томас Л. Мэдден, Алехандро А. Шаффер,
    Цзинхуэй Чжан, Чжэн Чжан, Уэбб Миллер и Дэвид Дж. Липман (1997),
    "Gapped BLAST и PSI-BLAST: новое поколение поиска в базе данных белков
    программ », Nucleic Acids Res. 25: 3389-3402.
    
    Query = gi | 12548788 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 3
    предшественник изоформы 2 [Homo sapiens]
             (473 буквы)
    
    База данных: hs.faa
               37 866 последовательностей; 18 247 518 писем
    
    Ищу ..................................................сделано
    
                                                                     Оценка E
    Последовательности, производящие значительные выравнивания: (биты) Значение
    
    gi | 12548788 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 3 составляет ... 963 0,0
    gi | 4503867 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 3 изо ... 909 0,0
    gi | 4503865 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 2 изо ... 752 0,0
    gi | 12548785 рецептор гамма-аминомасляной кислоты (ГАМК), бета 2... 734 0,0
    gi | 194097327 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 1 p ... 721 0,0
    gi | 8924258 рецептор гамма-аминомасляной кислоты (ГАМК), тета-предшественник ... 368 e-102
    gi | 34734071 рецептор гамма-аминомасляной кислоты (ГАМК) A, дельта до ... 343 3e-94
    gi | 194097386 рецептор гамма-аминомасляной кислоты (ГАМК), rho 1 [Hom ... 330 1e-90
    gi | 153266866 рецептор гамма-аминомасляной кислоты (ГАМК), rho 2 пре ... 324 9e-89
    gi | 157743288 рецептор гамма-аминомасляной кислоты (ГАМК), rho 3 [Hom ... 314 1e-85
    gi | 7657106 рецептор гамма-аминомасляной кислоты (ГАМК) A, пи [Homo s... 314 1э-85
    gi | 110347441 рецептор глицина, альфа-3 изоформа a [Homo sapiens] 293 2e-79
    gi | 169646723 рецептор глицина, альфа 2 изоформа A [Homo sapiens] 292 4e-79
    gi | 4504021 рецептор глицина, альфа 2 изоформа A [Homo sapiens] 292 4e-79
    gi | 169646728 рецептор глицина, альфа 2 изоформа B [Homo sapiens] 292 5e-79
    gi | 2257 рецептор глицина, предшественник изоформы 1 альфа 1 [Homo ... 288 7e-78
    gi | 38788155 рецептор гамма-аминомасляной кислоты A, изоформа гамма 2 ... 286 2e-77
    gi | 110347433 рецептор глицина, альфа-3 изоформа b [Homo sapiens] 286 2e-77
    gi | 119372310 рецептор глицина, предшественник изоформы 2 альфа-1 [Homo... 286 4e-77
    gi | 38788135 рецептор гамма-аминомасляной кислоты A, изоформа гамма 2 ... 285 5e-77
    gi | 218156328 рецептор глицина, предшественник альфа-4 [Homo sapiens] 282 5e-76
    gi | 4503861 рецептор гамма-аминомасляной кислоты (ГАМК) A, альфа 5 пр ... 280 2e-75
    gi | 31742490 рецептор гамма-аминомасляной кислоты A, предшественник гамма-1 ... 279 5e-75
    gi | 167000817 рецептор гамма-аминомасляной кислоты A, альфа 2 [Homo s ... 276 2e-74
    gi | 167000751 рецептор гамма-аминомасляной кислоты A, предшественники альфа 2 ... 276 2e-74
    gi | 4557603 рецептор гамма-аминомасляной кислоты A, предшественник альфа-3... 276 2e-74
    gi | 110347416 рецептор гамма-аминомасляной кислоты (ГАМК) A, гамма 3 ... 271 1e-72
    gi | 34452723 рецептор гамма-аминомасляной кислоты A, предшественник альфа-4 ... 268 1e-71
    gi | 18

    62 рецептор гамма-аминомасляной кислоты A, изоформа гамма 2 ... 265 7e-71 gi | 18

    34 рецептор гамма-аминомасляной кислоты (ГАМК) A, альфа 1 ... 265 7e-71 > gi | 12548788 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 3 предшественник изоформы 2 [Homo sapiens] Длина = 473 Оценка = 963 бита (2489), ожидание = 0.0 Идентичности = 473/473 (100%), Положительные = 473/473 (100%) Запрос: 1 MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP 60 MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP Sbjct: 1 MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP 60 Запрос: 61 VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD 120 VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD Sbjct: 61 VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD 120 Запрос: 121 TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE 180 TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE Sbjct: 121 TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE 180 Запрос: 181 SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK 240 SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK Sbjct: 181 SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK 240 Запрос: 241 RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI 300 RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI Sbjct: 241 RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI 300 Запрос: 301 PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR 360 PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR Sbjct: 301 PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR 360 Запрос: 361 VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS 420 VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS Sbjct: 361 VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS 420 Запрос: 421 LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN Sbjct: 421 LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 > gi | 4503867 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 3 предшественник изоформы 1 [Homo sapiens] Длина = 473 Оценка = 909 бит (2348), ожидание = 0.0 Идентичности = 447/448 (99%), Положительные = 448/448 (100%) Запрос: 26 RSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT 85 + SVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT Sbjct: 26 QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT 85 Запрос: 86 MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 145 MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP Sbjct: 86 MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 145 Запрос: 146 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER 205 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER Sbjct: 146 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER 205 Запрос: 206 IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF 265 IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF Sbjct: 206 IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF 265 Запрос: 266 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA 325 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA Sbjct: 266 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA 325 Запрос: 326 FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI 385 FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI Sbjct: 326 FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI 385 Запрос: 386 GDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDV 445 GDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDV Sbjct: 386 GDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDV 445 Запрос: 446 NAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 NAIDRWSRIVFPFTFSLFNLVYWLYYVN Sbjct: 446 NAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 > gi | 4503865 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 2 изоформа 2 [Homo sapiens] Длина = 474 Оценка = 752 бита (1942), ожидание = 0.0 Идентичности = 367/450 (81%), положительные = 404/450 (89%), пробелы = 2/450 (0%) Запрос: 26 RSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT 85 + SVNDP NMS VKETVD + LLKGYDIRLRPDFGGPPV VGMNIDIASIDMVSEVNMDYTLT Sbjct: 25 QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT 84 Запрос: 86 MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 145 MYFQQ WRDKRL + ​​Y + IPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP Sbjct: 85 MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 144 Запрос: 146 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER 205 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRG D AVTGV + Sbjct: 145 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK 204 Запрос: 206 IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF 265 IELPQFSIV +++ L +++ VVF + TG + YPRLSLSF + LKRNIGYFILQTYMPSILITILSWVSF Sbjct: 205 IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF 264 Запрос: 266 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA 325 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVF + ALLEYA Sbjct: 265 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA 324 Запрос: 326 FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEM - NEVSG 383 VNYIFFGRGPQRQKK AEK A A N ++ + + N ++ D H NILL ++ LE + NEM + E Sbjct: 325 LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDPHENILLSTLEIKNEMATSEAVM 384 Запрос: 384 GIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLT 443 G + GD R ++ +++ D S IQYRK + PR GR + R + KK + LRRR + SQLKI IPDLT Sbjct: 385 GLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLT 444 Запрос: 444 DVNAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 DVNAIDRWSRI FP FS FN + VYWLYYVN Sbjct: 445 DVNAIDRWSRIFFPVVFSFFNIVYWLYYVN 474 > gi | 12548785 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 2 изоформа 1 [Homo sapiens] Длина = 512 Оценка = 734 бита (1895), ожидание = 0.0 Идентичности = 367/488 (75%), положительные = 404/488 (82%), пробелы = 40/488 (8%) Запрос: 26 RSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT 85 + SVNDP NMS VKETVD + LLKGYDIRLRPDFGGPPV VGMNIDIASIDMVSEVNMDYTLT Sbjct: 25 QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT 84 Запрос: 86 MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 145 MYFQQ WRDKRL + ​​Y + IPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP Sbjct: 85 MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP 144 Запрос: 146 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER 205 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRG D AVTGV + Sbjct: 145 DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK 204 Запрос: 206 IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF 265 IELPQFSIV +++ L +++ VVF + TG + YPRLSLSF + LKRNIGYFILQTYMPSILITILSWVSF Sbjct: 205 IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF 264 Запрос: 266 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA 325 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVF + ALLEYA Sbjct: 265 WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA 324 Запрос: 326 FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRV ------------------------ 361 VNYIFFGRGPQRQKK AEK A A N ++ + + N ++ Sbjct: 325 LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP 384 Запрос: 362 -------------- DAHGNILLTSLEVHNEM - NEVSGGIGDTRNSAISFDNSGIQYRKQ 405 D H NILL ++ LE + NEM + E G + GD R ++ +++ D S IQYRK Sbjct: 385 TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA 444 Запрос: 406 SMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNL 465 + PR GR + R + KK + LRRR + SQLKI IPDLTDVNAIDRWSRI FP FS FN + Sbjct: 445 GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI 504 Запрос: 466 VYWLYYVN 473 ВЫВЛЫВН Sbjct: 505 VYWLYYVN 512 > gi | 194097327 рецептор гамма-аминомасляной кислоты (ГАМК) A, бета 1 предшественник [Homo sapiens] Длина = 474 Оценка = 721 бит (1860), Ожидание = 0.0 Идентичности = 357/451 (79%), положительные = 399/451 (88%), пробелы = 7/451 (1%) Запрос: 27 SVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTM 86 S N + P NMS + VKETVD + LLKGYDIRLRPDFGGPPV Идентификатор VGM + ASIDMVSEVNMDYTLTM Sbjct: 27 STNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTM 86 Запрос: 87 YFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPD 146 YFQQ W + DKRL + ​​YSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPD Sbjct: 87 YFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPD 146 Запрос: 147 GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERI 206 GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW GG + AVTGV + I Sbjct: 147 GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKI 206 Запрос: 207 ELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFW 266 ELPQFSIV ++++ VS + V F TGAYPRLSLSFRLKRNIGYFILQTYMPS LITILSWVSFW Sbjct: 207 ELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFW 266 Запрос: 267 INYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAF 326 INYDASAARVALGITTVLTMTTI + THLRETLPKIPYVKAID + YLMGCFVFVFLALLEYAF Sbjct: 267 INYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAF 326 Запрос: 327 VNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR - VDAHGNILLTSLEVHNEM - NEVS 382 VNYIFFG + GP QKK A K ++ N +++ K E N + VDAHGNILL ++ LE + NE + EV Sbjct: 327 VNYIFFGKGP - QKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVL 384 Запрос: 383 GGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDL 442 + D + + S + D ++ IQYRK RE + GR L + P K + RRR + SQLK + KIPDL Sbjct: 385 TSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVP-SKGRIRRRASQLKVKIPDL 443 Запрос: 443 TDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN 473 TDVN + ID + WSR + FP TFSLFN + VYWLYYV + Sbjct: 444 TDVNSIDKWSRMFFPITFSLFNVVYWLYYVH 474 > gi | 8924258 рецептор гамма-аминомасляной кислоты (ГАМК), предшественник тета [Homo sapiens] Длина = 632 Оценка = 368 бит (945), Ожидание = e-102 Идентичности = 162/309 (52%), положительные = 235/309 (76%) Запрос: 33 NMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYW 92 N + V ++ + D ++ L YD + RLRP + FGG PV V ++ I + SI + + SE + NMDYT + TM + F Q W Sbjct: 55 NEAVVQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTSIEQISEMNMDYTITMFFHQTW 114 Запрос: 93 RDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYG 152 + D RLAY LNLTLD R + ++ LWVPD YFLN K + FVH VTV + NR + + LHPDGTV YG Sbjct: 115 KDSRLAYYETTLNLTLDYRMHEKLWVPDCYFLNSKDAFVHDVTVENRVFQLHPDGTVRYG 174 Запрос: 153 LRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFS 212 + R + TTTAAC + DL ++ P + D + Q C L + ESYGYT + DI + W A + E + + PQF + Sbjct: 175 IRLTTTAACSLDLHKFPMDKQACNLVVESYGYTVEDIILFWDDNGNAIHMTEELHIPQFT 234 Запрос: 213 IVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDAS 272 + + S + V F TG + Y RL L F +++ R + +++ Q Y P ++ L TI SW + SFW + NYD + S Sbjct: 235 FLGRTITSKEVYFYTGSYIRLILKFQVQREVNSYLVQVYWPTVLTTITSWISFWMNYDSS 294 Запрос: 273 AARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 332 AARV + G + T ++ L + TTI ++ HLR + LP I + KAID + Y ++ C FVFL + LLEY ++ NY + F + Sbjct: 295 AARVTIGLTSMLILTTIDSHLRDKLPNISCIKAIDIYILVCLFFVFLSLLEYVYINYLFY 354 Запрос: 333 GRGPQRQKK 341 RGP + RQ + Sbjct: 355 SRGPRRQPR 363 Оценка = 44.3 бита (103), Expect = 2e-04 Идентичности = 15/28 (53%), Положительные = 22/28 (78%) Запрос: 445 VNAIDRWSRIVFPFTFSLFNLVYWLYYV 472 V + D + WSR + FP F LFN + VYW + Y ++ Sbjct: 604 VPKVDKWSRFLFPLAFGLFNIVYWVYHM 631 > gi | 34734071 рецептор гамма-аминомасляной кислоты (ГАМК) A, дельта предшественник [Homo sapiens] Длина = 452 Оценка = 343 бита (879), Ожидание = 3e-94 Идентичности = 194/476 (40%), положительные = 291/476 (61%), пробелы = 44/476 (9%) Запрос: 8 LLLPIWLSWTLGTRGSEPRSVNDPGN ------- MSFVKETVDKLLKGYDIRLRPDFGGPP 60 LL P + L RG + R ++ ND G + + S ++ + D L + GY RP GGPP Sbjct: 7 LLAPLLLLCAQQLRGT - RAMNDIGDYVGSNLEISWLPN-LDGLIAGYARNFRPGIGGPP 63 Запрос: 61 VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD 120 V V + +++ ASID + SE NM + YT + T ++ Q WRD RL + Y + L LD + R D + LW + PD Sbjct: 64 VNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLWLPD 123 Запрос: 121 TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE 180 T + + N K ++ H VTV + N ++ IRL PDG + LY + RIT + T AC MDL + YP + DEQ C L ++ E Sbjct: 124 TFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECMLDLE 183 Запрос: 181 SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVF-ATGAYPRLSLSFRL 239 SYGY +++ DI + YW + + G +++++ L QF + I + R + + F + G + PRLSL F L Sbjct: 184 SYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLHFHL 243 Запрос: 240 KRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPK 299 + RN G + I + Q + YMPS + L + + SWVSFWI + A ARV + LGITTVLTMTT + R + LP + Sbjct: 244 RRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSLPR 303 Запрос: 300 IPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESN 359 + KA + D + Y C + VFVF AL + EYAF ++ R + K + AK K R ++ E Sbjct: 304 ASAIKALDVYFWICYVFVFAALVEYAFAHF ---- NADYRKK ---- QKAKVKVSRPRAE - 353 Запрос: 360 RVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPRE - GHGRFLG 417 + D I + L SL G T + AIS R ++ + P G R + G Sbjct: 354 -MDVRNAIVLFSL ---------- SAAGVTQELAIS ------- RRQRRVPGNLMGSYRSVG 395 Запрос: 418 DRSLPHKKTHLRRRSSQ - LKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 + KK R Q ++ ++ + D + ID ++ R VFP F + N ++ YW Y Sbjct: 396 VETGETKKEGAARSGGQGGIRARLRPI-DADTIDIYARAVFPAAFAAVNVIYWAAY 450 > gi | 194097386 рецептор гамма-аминомасляной кислоты (ГАМК), rho 1 [Homo sapiens] Длина = 479 Оценка = 330 бит (847), Ожидание = 1e-90 Идентичности = 176/423 (41%), положительные = 268/423 (63%), пробелы = 33/423 (7%) Запрос: 48 YDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY-SGIPLNL 106 + D + RP FGGP + VG +++ + S + D + SEV + MD + T + T + Y + YW + D + RL ++ S L ++ Sbjct: 84 HDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPSTNNLSM 143 Запрос: 107 TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLR 166 T D R + ++ WVPD + F ++ K + SF + H T N M + R + PDG VLY LR + T TA C MD Sbjct: 144 TFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFS 203 Запрос: 167 RYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVF- 225 R + PLD Q C + LEIESY YT DD + YW + G + ++ ERI L QF I E ++ + Sbjct: 204 RFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTDERISLSQFLIQEFHTTTKLAFYS 263 Запрос: 226 ATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLT 285 + TG Y RL ++ F L + R + I + F + LQTY P + L + + LSWVSFWI + A ARV LGITTVLT Sbjct: 264 STGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLT 323 Запрос: 286 MTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEK 345 M + TI T + ++ P ++ Y + KA + D + YL FVFVFL ++ LEYA VNY + + ++++ KL EK Sbjct: 324 MSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQ-ERKEQKLREK 382 Запрос: 346 TAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQ 405 ++ + + L E + N ++ + + D + Q Sbjct: 383 LPC --------- TSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP --- DRMMVQLTLA 430 Запрос: 406 SMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNL 465 S + RS P + K + + RSS + ++ I D + AID ++ SRI + FP + LFNL Sbjct: 431 S ----------- ERSSPQRKS --- QRSSYVSMRI ---- DTHAIDKYSRIIFPAAYILFNL 472 Запрос: 466 VYW 468 + YW Sbjct: 473 IYW 475 > gi | 153266866 рецептор гамма-аминомасляной кислоты (ГАМК), rho 2 предшественник [Homo sapiens] Длина = 490 Оценка = 324 бита (831), ожидание = 9e-89 Идентичности = 172/434 (39%), положительные = 262/434 (60%), пробелы = 49/434 (11%) Запрос: 48 YDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIP-LNL 106 + D + RP FGGP + VG +++ + S + D + SEV + MD + T + T + Y + YW + D + RLA + S ++ Sbjct: 89 HDFSMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASNKSM 148 Запрос: 107 TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLR 166 T D R + ++ WVPD + F ++ K + SF H T N M + R + PDG VLY + RIT TA C MD Sbjct: 149 TFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNMDFS 208 Запрос: 167 RYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFA 226 + PLD Q C + LE + ESY YT + D + YW + GD +++ E + I L QF I + SR ++ Sbjct: 209 HFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLAFYS 268 Запрос: 227 -TGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLT 285 TG Y RL ++ F L + R + I + F + LQTY P + L + + LSWVSFWI + A АРВ + LGITTVLT Sbjct: 269 STGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITTVLT 328 Запрос: 286 MTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAE- 344 MTTI T + ++ P ++ YVKA + D + YL FVFVFL ++ LEYA VNY + + ++++ KL E Sbjct: 329 MTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQ-ERKERKLREK 387 Запрос: 345 ---------- KTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAIS 394 КТ S + SE + N + + + + E + V G + N + A Sbjct: 388 FPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA - 445 Запрос: 395 FDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRI 454 + K L + + + I + + AID ++ SR + Sbjct: 446 ----------------------------- RKKGLLKGQTGFRI ---- FQNTHAIDKYSRL 472 Запрос: 455 VFPFTFSLFNLVYW 468 + FP ++ FNL + YW Sbjct: 473 IFPASYIFFNLIYW 486 > gi | 157743288 рецептор гамма-аминомасляной кислоты (ГАМК), rho 3 [Homo sapiens] Длина = 467 Оценка = 314 бит (804), ожидание = 1e-85 Идентичности = 173/428 (40%), положительные = 259/428 (60%), пробелы = 35/428 (8%) Запрос: 49 DIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY-SGIPLNLT 107 D + RP FGG PV VG +++ + SID + SE NMD + T + T Y + YW + D + RL ++ S ++ T Sbjct: 71 DFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLSFPSTANKSMT 130 Запрос: 108 LDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRR 167 D + R + ++ WVPD + F ++ K + SF + H T ++ N M + R + HPDG VL LRIT + A C MD R Sbjct: 131 FDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITVSAMCFMDFSR 190 Запрос: 168 YPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVF - 225 + PLD QNC + LE + ESY Y DD + YW + G + K ++ E + L QF + E S + F Sbjct: 191 FPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQF-FIEDFSASSGLAFYS 249 Запрос: 226 ATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLT 285 + TG Y RL ++ F L + R ++ + F + LQTY P + IL + + LSWVSFWI + A АРВ + LGITTVLT Sbjct: 250 STGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARVSLGITTVLT 309 Запрос: 286 MTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEK 345 M + TI T + ++ P ++ Y + KA + D + YL + FVFL +++ EYA VNY + ++ K + K Sbjct: 310 MSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYL ---- TTVEERKQFKK 365 Запрос: 346 TAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQ 405 Т К С + ДА + + Э + Д +++ С ++ РК Sbjct: 366 TGKI ------ SRMYNIDAVQAMAFDGCYHDSEI -------- DMDQTSLSLNSEDFMRRKS 411 Запрос: 406 -SMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFN 464 P R RR + S + L + + ID + SRI + FP + LFN Sbjct: 412 ICSPSTDSSRI ------------ KRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFN 459 Запрос: 465 LVYWLYYV 472 L YW YV Sbjct: 460 LFYWGVYV 467 > gi | 7657106 рецептор гамма-аминомасляной кислоты (ГАМК) A, пи [Homo sapiens] Длина = 440 Оценка = 314 бит (804), ожидание = 1e-85 Идентичности = 174/432 (40%), положительные = 252/432 (58%), пробелы = 36/432 (8%) Запрос: 42 DKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSG 101 + L GY + LRP + FGG PV + + + DIASI + SE NMDYT T + Y + Q W D + RL + G Sbjct: 42 ENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISESNMDYTATIYLRQRWMDQRLVFEG 101 Запрос: 102 IPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAAC 161 + TLD R + + LWVPDTY + KKSF + H VTV NR + IRL + GTVLY LRITTT AC Sbjct: 102 NK-SFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVAC 160 Запрос: 162 MMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSR 221 MDL + YP + D Q C L ++ ES + GY + D + EF W G + + V G + E + L Q ++ I + + Sbjct: 161 NMDLSKYPMDTQTCKLQLESWGYDGNDVEFTWLRGNDSVRGLEHLRLAQYTIERYFTLVT 220 Запрос: 222 NVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIT 281 TG Y RL L F L + RN + YFIL + TY + PS + + LSWVSFWI + D + AR + G + T Sbjct: 221 RSQQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVT 280 Запрос: 282 TVLTMTTINTHLRETLPKIP-YVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQK 340 TVL + MTT + R + LP ++ KAID + YL CF FVF АЛЛЕЯ + Y Sbjct: 281 TVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHY ---------- S 330 Запрос: 341 KLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGI 400 L + AK DR ++ + NI + + S + ++ I + + Sbjct: 331 SLQQMAAK --- DRGTTKEVEEVSITNIINSSISSFKRKISF --------- ASIEISSDNV 378 Запрос: 401 QYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTF 460 Y + M + F + R + ++ + + + + + D + S +++ FP F Sbjct: 379 DYSDLTMKTSDKFKFV ----------- FREKMGRI-VDYFTIQNPSNVDHYSKLLFPLIF 426 Запрос: 461 SLFNLVYWLYYV 472 L N + YW YY + Sbjct: 427 MLANVFYWAYYM 438 > gi | 110347441 рецептор глицина, альфа-3 изоформа а [Homo sapiens] Длина = 464 Оценка = 293 бита (750), ожидание = 2e-79 Идентичности = 169/436 (38%), положительные = 252/436 (57%), пробелы = 36/436 (8%) Запрос: 41 VDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRL 97 + DKL + GYD R + RP + F GPPV V NI I S ++ E MDY + ++ + Q W D RL Sbjct: 47 LDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRL 106 Запрос: 98 AYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT 156 AYS P + L LD + D + W PD + F N + K + H VT N +++ R + + G VLY + R + T Sbjct: 107 AYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLT 166 Запрос: 157 TTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEH 216 T + C MDL + + P + D Q C +++ ES + GYT + D + F W + + V E + LPQF + E Sbjct: 167 LTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQD-EAPVQVAEGLTLPQFLLKEE 225 Запрос: 217 R-LVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAAR 275 + L + TG + + + F L + R + GY +++ Q Y + PS + LI ILSWVSFWIN DA + AR Sbjct: 226 KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPAR 285 Запрос: 276 VALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRG 335 VALGITTVLTMTT ++ R + LPK + YVKAID +++ C + FVF АЛЛЕЯ ВН ++ Sbjct: 286 VALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFV ----- 340 Запрос: 336 PQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISF 395 ++ K + L K KN K + E + + LE +++ + ++ R S ++ Sbjct: 341 SRQHKELLRFRRKRKN --- KTEA ----------- FALEKFYRFSDMDDEVRESRFSFTAY 386 Запрос: 396 DNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIV 455 К M + G P + + + S K + + ID SR Sbjct: 387 GMGPCLQAKDGMTPKG ---------- PNHPVQVMPKSPDEMRKV-FIDRAKKIDTISRAC 435 Запрос: 456 FPFTFSLFNLVYWLYY 471 FP F + FN + YW + Y Sbjct: 436 FPLAFLIFNIFYWVIY 451 > gi | 169646723 рецептор глицина, альфа 2 изоформа A [Homo sapiens] Длина = 452 Оценка = 292 бита (748), ожидание = 4e-79 Идентичности = 174/454 (38%), положительные = 250/454 (55%), пробелы = 49/454 (10%) Запрос: 24 EPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNM 80 + RS P + + DKL + GYD R + RP + F GPPV V NI I S V + E M Sbjct: 31 DSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTM 90 Запрос: 81 DYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNR 139 DY + ++ + Q W D RLAYS P + L LD + D + W PD + F N + K + H VT N + Sbjct: 91 DYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNK 150 Запрос: 140 MIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKA 199 ++ R + + G VLY + R + T T + C MDL + + P + D Q CT +++ ES + GYT + D + F W D Sbjct: 151 LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLS-DGP 209 Запрос: 200 VTGVERIELPQFSIVEHRLVSRNVV-FATGAYPRLSLSFRLKRNIGYFILQTYMPSILIT 258 V E + LPQF + E + + + TG + + + F L + R + GY +++ Q Y + PS + LI Sbjct: 210 VQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIV 269 Запрос: 259 ILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVF 318 ILSWVSFWIN DA + ARVALGITTVLTMTT ++ R + LPK + YVKAID +++ C + FVF Sbjct: 270 ILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVF 329 Запрос: 319 LALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEM 378 АЛЛЕЯ VN ++ RQ K + + + ++ K E Sbjct: 330 AALLEYAAVNFV ------ SRQHKEFLRLRRRRQKRQNKEED -------------------- 363 Запрос: 379 NEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHG-RFLGDRSLPHKKTHLRRRSSQLKI 437 TR S + F G + + Q ++ G + LP + + K Sbjct: 364 -------- VTRESRFNFSGYGMGHCLQ - VKDGTAVKATPANPLPQPP ---- KDGDAIKK 409 Запрос: 438 KIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 K D ID SR FP F + FN + YW + Y Сообщение: 410 KFVD - RAKRIDTISRAAFPLAFLIFNIFNIFYWITY 441 > gi | 4504021 рецептор глицина, альфа 2 изоформа A [Homo sapiens] Длина = 452 Оценка = 292 бита (748), ожидание = 4e-79 Идентичности = 174/454 (38%), положительные = 250/454 (55%), пробелы = 49/454 (10%) Запрос: 24 EPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNM 80 + RS P + + DKL + GYD R + RP + F GPPV V NI I S V + E M Sbjct: 31 DSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTM 90 Запрос: 81 DYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNR 139 DY + ++ + Q W D RLAYS P + L LD + D + W PD + F N + K + H VT N + Sbjct: 91 DYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNK 150 Запрос: 140 MIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKA 199 ++ R + + G VLY + R + T T + C MDL + + P + D Q CT +++ ES + GYT + D + F W D Sbjct: 151 LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLS-DGP 209 Запрос: 200 VTGVERIELPQFSIVEHRLVSRNVV-FATGAYPRLSLSFRLKRNIGYFILQTYMPSILIT 258 V E + LPQF + E + + + TG + + + F L + R + GY +++ Q Y + PS + LI Sbjct: 210 VQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIV 269 Запрос: 259 ILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVF 318 ILSWVSFWIN DA + ARVALGITTVLTMTT ++ R + LPK + YVKAID +++ C + FVF Sbjct: 270 ILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVF 329 Запрос: 319 LALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEM 378 АЛЛЕЯ VN ++ RQ K + + + ++ K E Sbjct: 330 AALLEYAAVNFV ------ SRQHKEFLRLRRRRQKRQNKEED -------------------- 363 Запрос: 379 NEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHG-RFLGDRSLPHKKTHLRRRSSQLKI 437 TR S + F G + + Q ++ G + LP + + K Sbjct: 364 -------- VTRESRFNFSGYGMGHCLQ - VKDGTAVKATPANPLPQPP ---- KDGDAIKK 409 Запрос: 438 KIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 K D ID SR FP F + FN + YW + Y Сообщение: 410 KFVD - RAKRIDTISRAAFPLAFLIFNIFNIFYWITY 441 > gi | 169646728 рецептор глицина, альфа-2-изоформа B [Homo sapiens] Длина = 452 Оценка = 292 бита (747), ожидание = 5e-79 Идентичности = 173/454 (38%), положительные = 250/454 (55%), пробелы = 49/454 (10%) Запрос: 24 EPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNM 80 + RS P + + DKL + GYD R + RP + F GPPV V NI I S ++ E M Sbjct: 31 DSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTM 90 Запрос: 81 DYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNR 139 DY + ++ + Q W D RLAYS P + L LD + D + W PD + F N + K + H VT N + Sbjct: 91 DYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNK 150 Запрос: 140 MIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKA 199 ++ R + + G VLY + R + T T + C MDL + + P + D Q CT +++ ES + GYT + D + F W D Sbjct: 151 LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLS-DGP 209 Запрос: 200 VTGVERIELPQFSIVEHRLVSRNVV-FATGAYPRLSLSFRLKRNIGYFILQTYMPSILIT 258 V E + LPQF + E + + + TG + + + F L + R + GY +++ Q Y + PS + LI Sbjct: 210 VQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIV 269 Запрос: 259 ILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVF 318 ILSWVSFWIN DA + ARVALGITTVLTMTT ++ R + LPK + YVKAID +++ C + FVF Sbjct: 270 ILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVF 329 Запрос: 319 LALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEM 378 АЛЛЕЯ VN ++ RQ K + + + ++ K E Sbjct: 330 AALLEYAAVNFV ------ SRQHKEFLRLRRRRQKRQNKEED -------------------- 363 Запрос: 379 NEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHG-RFLGDRSLPHKKTHLRRRSSQLKI 437 TR S + F G + + Q ++ G + LP + + K Sbjct: 364 -------- VTRESRFNFSGYGMGHCLQ - VKDGTAVKATPANPLPQPP ---- KDGDAIKK 409 Запрос: 438 KIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 K D ID SR FP F + FN + YW + Y Сообщение: 410 KFVD - RAKRIDTISRAAFPLAFLIFNIFNIFYWITY 441 > gi | 2257 рецептор глицина, предшественник изоформы 1 альфа 1 [Homo sapiens] Длина = 457 Оценка = 288 бит (737), ожидание = 7e-78 Идентичности = 172/466 (36%), положительные = 254/466 (54%), пробелы = 41/466 (8%) Запрос: 12 IWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNID 68 ++ S RS P + S + + DKL + GYD R + RP + F GPPV V NI Sbjct: 16 VFFSLAASKEAEAARSAPKPMSPS --- DFLDKLMGRTSGYDARIRPNFKGPPVNVSCNIF 72 Запрос: 69 IASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDK 127 I S ++ E MDY + ++ + Q W D RLAY + P + L LD + D + W PD + F N + K Sbjct: 73 INSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDSIWKPDLFFANEK 132 Запрос: 128 KSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD 187 + H + T N +++ R + + G VLY + RIT T AC MDL + + P + D Q C +++ ES + GYT + Sbjct: 133 GAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMN 192 Запрос: 188 DIEFYWRGGDKAVTGVERIELPQFSIVEHR-LVSRNVVFATGAYPRLSLSFRLKRNIGYF 246 D + F W + AV + + LPQF + E + L + TG + + F L + R + GY + Sbjct: 193 DLIFEWQE-QGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYY 251 Запрос: 247 ILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAI 306 ++ Q Y + PS + LI ILSW + SFWIN DA + ARV LGITTVLTMTT ++ R + LPK + YVKAI Sbjct: 252 LIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAI 311 Запрос: 307 DMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGN 366 D +++ C + FVF АЛЛЕЯ VN ++ ++ K + L K ++ + S Sbjct: 312 DIWMAVCLLFVFSALLEYAAVNFV ----- SRQHKELLRFRRKRRHKS ------------ 354 Запрос: 367 ILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQ-SMPREGHGRFLGDRSLPHKK 425 + N E G G SA + + Q + S + + P K Sbjct: 355 ------ PMLNLFQEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKS 408 Запрос: 426 THLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 R + + K ID + SRI FP F + FN + YW + Y Сообщение: 409 PEEMRKLFIQRAK -------- KIDKISRIGFPMAFLIFNMFYWIIY 446 > gi | 38788155 рецептор гамма-аминомасляной кислоты А, гамма 2 изоформа 1 предшественник [Homo sapiens] Длина = 475 Оценка = 286 бит (733), ожидание = 2e-77 Идентичности = 158/437 (36%), положительные = 238/437 (54%), пробелы = 38/437 (8%) Запрос: 41 VDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYS 100 ++ LL + GYD + LRPD G P + ++ + SI V + + NM + YT + ++ F Q W D + RL ++ Sbjct: 70 LNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFN 129 Запрос: 101 GIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAA 160 L L ++ + ++ W + PDT + F N KK + H + T NRM + R + DG VLY LR + T A Sbjct: 130 STIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE 189 Запрос: 161 CMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS 220 C + L + P + DE + C LE SYGY ++ I + W + V L QFS V R + Sbjct: 190 CQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTT 249 Запрос: 221 RNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI 280 V + G Y + S + F L R + GYF + QTY + P LI + LSWVSFWIN DA AR + LGI Sbjct: 250 EVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGI 309 Запрос: 281 TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQK 340 TTVLTMTT ++ T R ++ LPK + YV A + D +++ CF + FVF AL + EY ++ Y R P + K Sbjct: 310 TTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDK 369 Запрос: 341 KLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI ----- GDTRNSAISF 395 + К + К + + + + + H + + G D + F Sbjct: 370 DKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCF 429 Запрос: 396 DNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIV 455 ++ R G R H + H + R + + D ++ RI Sbjct: 430 EDC ---------- RTGAWR -------- HGRIHIR --------------- IAKMDSYARIF 456 Запрос: 456 FPFTFSLFNLVYWLYYV 472 FP F LFNLVYW + Y + Sbjct: 457 FPTAFCLFNLVYWVSYL 473 > gi | 110347433 рецептор глицина, альфа-3-изоформа b [Homo sapiens] Длина = 449 Оценка = 286 бит (733), ожидание = 2e-77 Идентичности = 165/436 (37%), положительные = 243/436 (55%), пробелы = 51/436 (11%) Запрос: 41 VDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRL 97 + DKL + GYD R + RP + F GPPV V NI I S ++ E MDY + ++ + Q W D RL Sbjct: 47 LDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRL 106 Запрос: 98 AYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT 156 AYS P + L LD + D + W PD + F N + K + H VT N +++ R + + G VLY + R + T Sbjct: 107 AYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLT 166 Запрос: 157 TTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEH 216 T + C MDL + + P + D Q C +++ ES + GYT + D + F W + + V E + LPQF + E Sbjct: 167 LTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQD-EAPVQVAEGLTLPQFLLKEE 225 Запрос: 217 R-LVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAAR 275 + L + TG + + + F L + R + GY +++ Q Y + PS + LI ILSWVSFWIN DA + AR Sbjct: 226 KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPAR 285 Запрос: 276 VALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRG 335 VALGITTVLTMTT ++ R + LPK + YVKAID +++ C + FVF АЛЛЕЯ ВН ++ Sbjct: 286 VALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFV ----- 340 Запрос: 336 PQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISF 395 ++ К + L К КН + + R + + G + G + Sbjct: 341 SRQHKELLRFRRKRKNKDDEVRESR ----------------- FSFTAYGMGPCLQAKDGM 383 Запрос: 396 DNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIV 455 G + Q MP + S +++ + ID SR Sbjct: 384 TPKGPNHPVQVMPK ----------------------- SPDEMRKVFIDRAKKIDTISRAC 420 Запрос: 456 FPFTFSLFNLVYWLYY 471 FP F + FN + YW + Y Sbjct: 421 FPLAFLIFNIFYWVIY 436 > gi | 119372310 рецептор глицина, предшественник изоформы 2 альфа 1 [Homo sapiens] Длина = 449 Оценка = 286 бит (731), ожидание = 4e-77 Идентичности = 169/465 (36%), положительные = 250/465 (53%), пробелы = 47/465 (10%) Запрос: 12 IWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNID 68 ++ S RS P + S + + DKL + GYD R + RP + F GPPV V NI Sbjct: 16 VFFSLAASKEAEAARSAPKPMSPS --- DFLDKLMGRTSGYDARIRPNFKGPPVNVSCNIF 72 Запрос: 69 IASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDK 127 I S ++ E MDY + ++ + Q W D RLAY + P + L LD + D + W PD + F N + K Sbjct: 73 INSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDSIWKPDLFFANEK 132 Запрос: 128 KSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD 187 + H + T N +++ R + + G VLY + RIT T AC MDL + + P + D Q C +++ ES + GYT + Sbjct: 133 GAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMN 192 Запрос: 188 DIEFYWRGGDKAVTGVERIELPQFSIVEHR-LVSRNVVFATGAYPRLSLSFRLKRNIGYF 246 D + F W + AV + + LPQF + E + L + TG + + F L + R + GY + Sbjct: 193 DLIFEWQE-QGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYY 251 Запрос: 247 ILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAI 306 ++ Q Y + PS + LI ILSW + SFWIN DA + ARV LGITTVLTMTT ++ R + LPK + YVKAI Sbjct: 252 LIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAI 311 Запрос: 307 DMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGN 366 D +++ C + FVF АЛЛЕЯ VN ++ R + + K K D + A + G Sbjct: 312 DIWMAVCLLFVFSALLEYAAVNFV - SRQHKELLRFRRKRRHHKEDEAGEGRFNFSAYG- 368 Запрос: 367 ILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKT 426 + Л + + ++ + Т Н + С + РК + Р Sbjct: 369 MGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQR ----------------- 411 Запрос: 427 HLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471 ID + SRI FP F + FN + YW + Y Sbjct: 412 ------------------ AKKIDKISRIGFPMAFLIFNMFYWIIY 438 > gi | 38788135 рецептор гамма-аминомасляной кислоты А, гамма 2 изоформа 2 предшественник [Homo sapiens] Длина = 467 Оценка = 285 бит (730), ожидание = 5e-77 Идентичности = 160/433 (36%), положительные = 240/433 (55%), пробелы = 38/433 (8%) Запрос: 41 VDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYS 100 ++ LL + GYD + LRPD G P + ++ + SI V + + NM + YT + ++ F Q W D + RL ++ Sbjct: 70 LNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFN 129 Запрос: 101 GIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAA 160 L L ++ + ++ W + PDT + F N KK + H + T NRM + R + DG VLY LR + T A Sbjct: 130 STIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE 189 Запрос: 161 CMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS 220 C + L + P + DE + C LE SYGY ++ I + W + V L QFS V R + Sbjct: 190 CQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTT 249 Запрос: 221 RNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI 280 V + G Y + S + F L R + GYF + QTY + P LI + LSWVSFWIN DA AR + LGI Sbjct: 250 EVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGI 309 Запрос: 281 TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQK 340 TTVLTMTT ++ T R ++ LPK + YV A + D +++ CF + FVF AL + EY ++ Y R P + K Sbjct: 310 TTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDK 369 Запрос: 341 KLAEKTAKAKND-RSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSG 399 + K D R + S + +++ ++ E E + D + F ++ Sbjct: 370 DKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK ---- DCASFFCCFEDC- 424 Запрос: 400 IQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFT 459 R G R H + H + R + + D ++ RI FP Sbjct: 425 --------- RTGAWR -------- HGRIHIR --------------- IAKMDSYARIFFPTA 452 Запрос: 460 FSLFNLVYWLYYV 472 F LFNLVYW + Y + Сообщение: 453 FCLFNLVYWVSYL 465 > gi | 218156328 рецептор глицина, предшественник альфа-4 [Homo sapiens] Длина = 417 Оценка = 282 бит (721), ожидание = 5e-76 Идентичности = 142/317 (44%), положительные = 207/317 (65%), пробелы = 14/317 (4%) Запрос: 19 GTRGSEPRSVNDPGNMSFVKETVDKLL --- KGYDIRLRPDFGGPPVCVGMNIDIASIDMV 75 GT + GS + P S + D + DKL + GYD R + RP + F GPPV V NI I S + Sbjct: 35 GTKGSQPMSPSD --------- FLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFSSI 85 Запрос: 76 SEVNMDYTLTMYFQQYWRDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGV 134 ++ MDY + ++ + Q W D RL + Y P + L LD + D + W PD + F N + K + H V Sbjct: 86 TKTTMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEV 145 Запрос: 135 TVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWR 194 T N +++ R + + G VLY + R + T + C + MDL + + P + D Q CT +++ ES + GYT D + F W Sbjct: 146 TTDNKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWL 205 Запрос: 195 GGDKAVTGVERIELPQFSIVEHR-LVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMP 253 AV E + LPQF + + + L + TG + + + F L + R + GY +++ Q Y + P Sbjct: 206 EDAPAVQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIP 265 Запрос: 254 SILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGC 313 S + LI ILSWVSFWIN DA + АРВ LGITTVLTMTT ++ R + LPK + YVKAID +++ C Sbjct: 266 SLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVC 325 Запрос: 314 FVFVFLALLEYAFVNYI 330 + ФВФ АЛЛЕЯ + Н ++ Sbjct: 326 LLFVFAALLEYAAINFV 342 > gi | 4503861 рецептор гамма-аминомасляной кислоты (ГАМК) A, альфа 5 предшественник [Homo sapiens] Длина = 462 Оценка = 280 бит (716), Ожидание = 2e-75 Идентичности = 167/481 (34%), положительные = 250/481 (51%), пробелы = 49/481 (10%) Запрос: 1 MCSGLLELLLPIWLSWTLGTRGSEPRSVNDP - GNMSFVKETVDKLLKGYDIRLRPDFGG 58 M LL + + LS G SV D N ++ + D LL GYD RLRP G Sbjct: 11 MIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGE 70 Запрос: 59 PPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWV 118 V + I + S VS + M + YT + ++ F + Q W + D + RL + G L L + N + A ++ W Sbjct: 71 RITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWT 130 Запрос: 119 PDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLE 178 PDT + F N KKS H + T N +++ RL DGT + LY + R + T + A C M L + P + D C L + Sbjct: 131 PDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLK 190 Запрос: 179 IESYGYTTDDIEFYWRGGD - KAVTGVERIELPQFSIVEHRLVSRNVVVFATGAYPRLSLS 236 SY Y ++ + W G V + L Q + ++ + + N + + TG Y ++ Sbjct: 191 FGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAH 250 Запрос: 237 FRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRET 296 F LKR IGYF ++ QTY + P I + ILS VSFW + N ++ AR G + TTVLTMTT ++ R + Sbjct: 251 FHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS 310 Запрос: 297 LPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKS 356 LPK + Y A + D ++ C + FVF AL + E + A VNY F RG K A + AK K R Sbjct: 311 LPKVAYATAMDWFIAVCYAFVFSALIEFATVNY-FTKRGWAWDGKKALEAAKIKKKREVI 369 Запрос: 357 ESNRVDAHGNILLTSLEVHNEMN ---- EVSGGIGDTRNSAISFDNSGIQYRKQSMPREGH 412 + + А Т + ++ + N + G + T + ++ P E Sbjct: 370 LNKSTNA ----- FTTGKMSHPPNIPKEQTPAGTSNTTSVSVK ------------- PSE-- 409 Запрос: 413 GRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYV 472 +++ KKT + ++ ID + SRIVFP F FNLVYW Y + Sbjct: 410 ----- EKTSESKKTY --------------- NSISKIDKMSRIVFPVLFGTFNLVYWATYL 449 Запрос: 473 N 473 N Sbjct: 450 N 450 > gi | 31742490 рецептор гамма-аминомасляной кислоты A, предшественник гамма-1 [Homo sapiens] Длина = 465 Оценка = 279 бит (713), ожидание = 5e-75 Идентичности = 161/436 (36%), положительные = 237/436 (54%), пробелы = 36/436 (8%) Запрос: 37 VKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKR 96 + + ++ LL + GYD + LRPD G P + ++ + SI V + NM + YT + + F Q W D R Sbjct: 64 ITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSR 123 Запрос: 97 LAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT 156 L ++ L L ++ + ++ W + PDT + F N + KS H + T NR ++ R + DG VLY LR + T Sbjct: 124 LKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLT 183 Запрос: 157 TTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEH 216 A C + L + P + DE + C LE SYGY ++ IE + W + V + L QF + V Sbjct: 184 INAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGL 243 Запрос: 217 RLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARV 276 R + + G Y +++ F L R + GYF + QTY + P IL + LSWVSFWIN DA AR Sbjct: 244 RNSTEITHTISGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPART 303 Запрос: 277 ALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGP 336 + LGITTVLTMTT ++ T R ++ LPK + YV A + D +++ CF + FVF AL + EY ++ Y Sbjct: 304 SLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYF ---- TS 359 Запрос: 337 QRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFD 396 ++ К А К К КН S + G + L + + + G SF Sbjct: 360 NQKGKTATKDRKLKNKASMTPGLH --- PGSTLIPMNNISVPQEDDYGYQCLEGKDCASFF 416 Запрос: 397 NSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVF 456 R S REG + H + R + ID + SRI F Sbjct: 417 CCFEDCRTGSW-REG ------------- RIHIR --------------- IAKIDSYSRIFF 447 Запрос: 457 PFTFSLFNLVYWLYYV 472 P F + LFNLVYW + Y + Sbjct: 448 PTAFALFNLVYWVGYL 463 > gi | 167000817 рецептор гамма-аминомасляной кислоты A, альфа 2 [Homo sapiens] Длина = 451 Оценка = 276 бит (707), Ожидание = 2e-74 Идентичности = 163/444 (36%), положительные = 242/444 (54%), пробелы = 42/444 (9%) Запрос: 33 NMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYW 92 N ++ + D + LL GYD RLRP G V NI + S VS + + M + YT + ++ F + Q W Sbjct: 38 NITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKW 97 Запрос: 93 RDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLY 151 + D + RL + G P + N L L + N + A ++ W PDT + F N KKS H + T + N +++ R + DGT + LY Sbjct: 98 KDERLKFKG-PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLY 156 Запрос: 152 GLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW - RGGDKAVTGVERIELP 209 + R + T A C M L + P + D + C L + SY YTT ++ + W D + L Sbjct: 157 TMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLN 216 Запрос: 210 QFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINY 269 Q + ++ + + + TG Y ++ F LKR IGYF ++ QTY + P I + ILS VSFW + N Sbjct: 217 QYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNR 276 Запрос: 270 DASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNY 329 ++ AR G + TTVLTMTT ++ R + LPK + Y A + D ++ C + FVF AL + E + A VNY Sbjct: 277 ESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNY 336 Запрос: 330 IFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTR 389 F RG A ND + K +++ V N ++ V N + S D Sbjct: 337 -FTKRG ------ WAWDGKSVVNDKKKEKAS-VMIQNNAY - AVAVANYAPNLS --- KDPV 383 Запрос: 390 NSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAID 449 S IS + + P P+KK + ++ V+ ID Sbjct: 384 LSTIS--------KSATTPE------------PNKKPENKPAEAK-----KTFNSVSKID 418 Query: 450 RWSRIVFPFTFSLFNLVYWLYYVN 473 R SRIVFP F FNLVYW Y+N Sbjct: 419 RMSRIVFPVLFGTFNLVYWATYLN 442 >gi|167000751 gamma-aminobutyric acid A receptor, alpha 2 precursor [Homo sapiens] Length = 451 Score = 276 bits (707), Expect = 2e-74 Identities = 163/444 (36%), Positives = 242/444 (54%), Gaps = 42/444 (9%) Запрос: 33 NMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYW 92 N++ +D+LL GYD RLRP G V NI + S VS+ +M+YT+ ++F+Q W Sbjct: 38 NITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKW 97 Query: 93 RDKRLAYSGIPLN-LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLY 151 +D+RL + G P+N L L+N +A ++W PDT+F N KKS H +T+ N+++R+ DGT+LY Sbjct: 98 KDERLKFKG-PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLY 156 Query: 152 GLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--RGGDKAVTGVERIELP 209 +R+T A C M L +P+D +C L+ SY YTT ++ + W D + L Sbjct: 157 TMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLN 216 Query: 210 QFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINY 269 Q+ ++ + + +TG Y ++ F LKR IGYF++QTY+P I+ ILS VSFW+N Sbjct: 217 QYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNR 276 Query: 270 DASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNY 329 ++ AR G+TTVLTMTT++ R +LPK+ Y A+D ++ C+ FVF AL+E+A VNY Sbjct: 277 ESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNY 336 Query: 330 IFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTR 389 F RG A ND+ K +++ V N ++ V N +S D Sbjct: 337 -FTKRG------WAWDGKSVVNDKKKEKAS-VMIQNNAY--AVAVANYAPNLS---KDPV 383 Query: 390 NSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAID 449 S IS + + P P+KK + ++ V+ ID Sbjct: 384 LSTIS--------KSATTPE------------PNKKPENKPAEAK-----KTFNSVSKID 418 Query: 450 RWSRIVFPFTFSLFNLVYWLYYVN 473 R SRIVFP F FNLVYW Y+N Sbjct: 419 RMSRIVFPVLFGTFNLVYWATYLN 442 >gi|4557603 gamma-aminobutyric acid A receptor, alpha 3 precursor [Homo sapiens] Length = 492 Score = 276 bits (707), Expect = 2e-74 Identities = 159/446 (35%), Positives = 239/446 (53%), Gaps = 33/446 (7%) Запрос: 33 NMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYW 92 N++ +D+LL GYD RLRP G V +I + S VS+ +M+YT+ ++F+Q W Sbjct: 63 NITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTW 122 Запрос: 93 RDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYG 152 D+RL + G L L+N +A ++W PDT+F N KKS H +T N+++RL +GT+LY Sbjct: 123 HDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYT 182 Query: 153 LRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWR-GGDKAV-TGVERIELPQ 210 +R+T A C M L +P+D C L+ SY YTT ++ + W G +K+V + L Q Sbjct: 183 MRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQ 242 Query: 211 FSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYD 270 + ++ H + + + +TG Y ++ F LKR IGYF++QTY+P I+ ILS VSFW+N + Sbjct: 243 YDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRE 302 Query: 271 ASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI 330 + AR G+TTVLTMTT++ R +LPK+ Y A+D ++ C+ FVF AL+E+A VNY Sbjct: 303 SVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYF 362 Query: 331 FFGRGPQRQKKLAEKTAKAKND---RSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGD 387 KK+ E K +K S + G +L E + +S G Sbjct: 363 TKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGAAP 422 Query: 388 TRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNA 447 + +S + S Q P E KT+ V+ Sbjct: 423 SASSTPTIIASPKATYVQDSPTE-------------TKTY---------------NSVSK 454 Query: 448 IDRWSRIVFPFTFSLFNLVYWLYYVN 473 +D+ SRI+FP F++FNLVYW YVN Sbjct: 455 VDKISRIIFPVLFAIFNLVYWATYVN 480 >gi|110347416 gamma-aminobutyric acid (GABA) A receptor, gamma 3 [Homo sapiens] Length = 467 Score = 271 bits (692), Expect = 1e-72 Identities = 153/432 (35%), Positives = 237/432 (54%), Gaps = 17/432 (3%) Query: 41 VDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYS 100 ++KLL+ YD +LRPD G P + ++I + SI VS +NM+Y + ++F Q W D RL ++ Sbjct: 51 LNKLLREYDKKLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFN 110 Query: 101 GIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAA 160 LTL++ + +W+PDT F N K + H +T N+++R+ DG +LY LR+T A Sbjct: 111 STMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAE 170 Query: 161 CMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS 220 C + L +P+DE +C L SYGY +++ + WR + L QF + R + Sbjct: 171 CQLQLHNFPMDEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTT 230 Query: 221 RNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI 280 V + G Y +++ F L R +GYF +QTY+P IL +LSWVSFWI DA+ AR ALGI Sbjct: 231 EIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGI 290 Query: 281 TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQK 340 TTVLTMTT++T R++LP++ YV A+D+++ CF+FVF AL+EYA +NY R P K Sbjct: 291 TTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTK 350 Query: 341 KLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGI 400 K T+ D S+ R+ + L++ + T N+++ + Sbjct: 351 K---TTSLLHPDSSRWIPERISLQAPSNYSLLDMRPPPTAMI-----TLNNSVYWQEFED 402 Query: 401 QYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTF 460 + + + F + R ++ I I +L D +SR+ FP +F Sbjct: 403 TCVYECLDGKDCQSFF---CCYEECKSGSWRKGRIHIDILEL------DSYSRVFFPTSF 453 Query: 461 SLFNLVYWLYYV 472 LFNLVYW+ Y+ Sbjct: 454 LLFNLVYWVGYL 465 >gi|34452723 gamma-aminobutyric acid A receptor, alpha 4 precursor [Homo sapiens] Length = 554 Score = 268 bits (684), Expect = 1e-71 Identities = 167/493 (33%), Positives = 256/493 (51%), Gaps = 61/493 (12%) Query: 41 VDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYS 100 +D LL GYD RLRP FGGP V +I + S VS+V M+YT+ ++F+Q W DKRL Y Sbjct: 52 LDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYD 111 Query: 101 GIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAA 160 G L L+N + ++W PDT+F N KKS H +T N++ R+ +GT+LY +R+T +A Sbjct: 112 GPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAE 171 Query: 161 CMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW-RGGDKAV-TGVERIELPQFSIVEHRL 218 C M L +P+D C L+ SY Y ++ + W +G +K+V E L Q+ ++ + Sbjct: 172 CPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTV 231 Query: 219 VSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVAL 278 S + TG Y +++ F L+R +GYF++QTY+P I+ ILS VSFWIN ++ AR Sbjct: 232 SSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVF 291 Query: 279 GITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNY---IFFGRG 335 GITTVLTMTT++ R +LPK+ Y A+D ++ CF FVF AL+E+A VNY I + Sbjct: 292 GITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKA 351 Query: 336 PQRQKKLAEKTAKAKNDRSK-SESNRVDAHGNILL---TSLEVHNEM---NEVSGGIGDT 388 ++ K ++ A R K E+ + + N+ + T+ VH+E N G + Sbjct: 352 KRKTSKPPQEVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSS 411 Query: 389 RNSAISFDNS----------------------------------------GIQYRKQSMP 408 ++S + ++S G RK S+ Sbjct: 412 KSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVG 471 Query: 409 REGHGRFLGDRSLPHKKTHLRRRSSQLKIKI--------PDLTDVNAIDRWSRIVFPFTF 460 G R L KT + + K+ P + + ID+++RI+FP TF Sbjct: 472 SASTRHVFGSR-LQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTF 530 Query: 461 SLFNLVYWLYYVN 473 FN+VYW+ Y++ Sbjct: 531 GAFNMVYWVVYLS 543 >gi|18

    62 gamma-aminobutyric acid A receptor, gamma 2 isoform 3 предшественник [Homo sapiens] Length = 515 Score = 265 bits (677), Expect = 7e-71 Identities = 157/477 (32%), Positives = 238/477 (49%), Gaps = 78/477 (16%) Query: 41 VDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYS 100 ++ LL+GYD +LRPD G P + ++ + SI V+ +NM+YT+ ++F Q W D+RL ++ Sbjct: 70 LNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFN 129 Query: 101 GIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAA 160 L L++ + ++W+PDT+F N KK+ H +T NRM+R+ DG VLY LR+T A Sbjct: 130 STIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE 189 Query: 161 CMMDLRRYPLDEQNCTLEIESY-------------------------------------- 182 C + L +P+DE +C LE S+ Sbjct: 190 CQLQLHNFPMDEHSCPLEFSSWSRSIAQAGMCSGVISAHYSLRFWGSTDPPTLASRVAGI 249 Query: 183 --GYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK 240 GY ++I + W+ V L QFS V R + V +G Y +S+ F L Sbjct: 250 SDGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLS 309 Запрос: 241 RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI 300 R +GYF +QTY+P LI +LSWVSFWIN DA AR +LGITTVLTMTT++T R++LPK+ Sbjct: 310 RRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKV 369 Запрос: 301 PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR 360 YV A+D+++ CF+FVF AL+EY ++Y R P + K +K + K+ + Sbjct: 370 SYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTID 429 Query: 361 VDAHGNILLTSLEVHNEMNEVSGGI-----GDTRNSAISFDNSGIQYRKQSMPREGHGRF 415 + + + H + + G D + F++ R G R Sbjct: 430 IRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDC----------RTGAWR- 478 Query: 416 LGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYV 472 H + H+R + +D ++RI FP F LFNLVYW+ Y+ Sbjct: 479 -------HGRIHIR---------------IAKMDSYARIFFPTAFCLFNLVYWVSYL 513 >gi|18

    34 gamma-aminobutyric acid (GABA) A receptor, alpha 1 предшественник [Homo sapiens] Length = 456 Score = 265 bits (677), Expect = 7e-71 Identities = 158/445 (35%), Positives = 232/445 (52%), Gaps = 42/445 (9%) Запрос: 33 NMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYW 92 N + +D+LL GYD RLRP G V +I + S VS+ +M+YT+ ++F+Q W Sbjct: 38 NTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSW 97 Запрос: 93 RDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYG 152 +D+RL + G L L+N +A ++W PDT+F N KKS H +T+ N+++R+ DGT+LY Sbjct: 98 KDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYT 157 Query: 153 LRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--RGGDKAVTGVERIELPQ 210 +R+T A C M L +P+D C L+ SY YT ++ + W V + L Q Sbjct: 158 MRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQ 217 Query: 211 FSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYD 270 + ++ + S V +TG Y ++ F LKR IGYF++QTY+P I+ ILS VSFW+N + Sbjct: 218 YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRE 277 Query: 271 ASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI 330 + AR G+TTVLTMTT++ R +LPK+ Y A+D ++ C+ FVF AL+E+A VNY Sbjct: 278 SVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNY- 336 Query: 331 FFGRGPQRQKK--LAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDT 388 F RG K + EK K K+ K + T+ + G+ Sbjct: 337 FTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAP-------TATSYTPNLARGDPGLATI 389 Query: 389 RNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAI 448 SA + + ++ P E KKT V+ I Sbjct: 390 AKSATIEPK---EVKPETKPPE------------PKKT---------------FNSVSKI 419 Query: 449 DRWSRIVFPFTFSLFNLVYWLYYVN 473 DR SRI FP F +FNLVYW Y+N Sbjct: 420 DRLSRIAFPLLFGIFNLVYWATYLN 444 Database: hs.фаа Дата добавления: 4 августа 2009 г., 16:42 Количество писем в базе: 18 247 518 Количество последовательностей в базе данных: 37 866 Лямбда K H 0,324 0,139 0,426 Пробел Лямбда K H 0,267 0,0410 0,140 Матрица: BLOSUM62 Штрафы за пробелы: Существование: 11, Продление: 1 Число обращений к БД: 16,757,288 Количество последовательностей: 37866 Количество расширений: 683233 Количество успешных продлений: 1690 Количество последовательностей лучше 10,0: 30 Количество HSP лучше 10,0 без пропусков: 66 Количество HSP, успешно прошедших предварительный тест: 9 Количество HSP, которые пытались сделать разрыв в предварительном тесте: 1510 Количество пропущенных HSP (без предварительной оценки): 117 длина запроса: 473 длина базы данных: 18 247 518 эффективная длина HSP: 106 эффективная длина запроса: 367 эффективная длина базы данных: 14 233 722 эффективное пространство поиска: 5223775974 эффективное используемое пространство поиска: 5223775974 Т: 11 А: 40 Х1: 15 (7.0 бит) X2: 38 (14,6 бит) X3: 64 (24,7 бит) S1: 41 (22,0 бит) S2: 64 (29,3 бит)


    Результаты поиска были получены с записями NCBI BLAST и RefSeq.


    1250000 VEF в GYD — Венесуэльский боливар À Гайанский доллар Обменный пункт

    1250000 VEF знак равно 0,00 ГЙД

    1250000 Венесуэльский боливар знак равно 0.00 долларовый гайан

    6250000 ВЭФ знак равно 0,00 ГЙД

    6250000 Боливар Венесуэльен знак равно 0,00 гайана доллара

    12500000 ВЭФ знак равно 0,01 ГЙД

    12500000 Боливар Венесуэльен знак равно 0.01 долларовый гайан

    62500000 ВЭФ знак равно 0,03 ГЙД

    62500000 Боливар Венесуэльен знак равно 0,03 гайана доллара

    125000000 VEF знак равно 0,06 ГЙД

    125000000 Боливар Венесуэльен знак равно 0.06 долларовый гайан

    312500000 ВЭФ знак равно 0,16 ГЙД

    312500000 Боливар Венесуэльен знак равно 0,16 гайана доллара

    625000000 VEF знак равно 0,32 ГЙД

    625000000 Боливар Венесуэльен знак равно 0.32 доллара гайана

    1250000000 ВЭФ знак равно 0,64 ГЙД

    1250000000 Боливар Венесуэльен знак равно 0,64 гайана доллара

    6250000000 ВЭФ знак равно 3,22 GYD

    6250000000 Боливар Венесуэльен знак равно 3.22 гайана доллара

    12500000000 ВЭФ знак равно 6,44 GYD

    12500000000 Боливар Венесуэльен знак равно 6.44 Гайана доллара

    62500000000 ВЭФ знак равно 32,18 GYD

    62500000000 Боливар Венесуэльен знак равно 32.Гайана за 18 долларов

    125000000000 ВЭФ знак равно 64,36 GYD

    125000000000 Боливар Венесуэльен знак равно 64,36 Гайана доллара

    625000000000 ВЭФ знак равно 321,82 GYD

    625000000000 Боливар Венесуэльен знак равно 321.82 гайана доллара

    1250000000000 ВЭФ знак равно 643,65 GYD

    1250000000000 Боливар Венесуэльен знак равно 643,65 долларов в гаянах

    6250000000000 ВЭФ знак равно 3218,25 GYD

    6250000000000 Боливар Венесуэльен знак равно 3218.25-долларовый гайан

    125000000000000 ВЭФ знак равно 64365,00 GYD

    125000000000000 Боливар Венесуэльен знак равно 64365.00 Гаяна в долларах

    (на 5 сентября 2021 г.)

    Сколько стоит преобразовать Венесуэльский боливар в доллар гайана (конвертировать GYD в VEF)? См. Обмен GYD на VEF.

    1000 VEF в GYD — Венесуэльский боливар À Гайанский доллар Обменный пункт

    1000 ВЭФ знак равно 0,00 ГЙД

    1000 Венесуэльских боливаров знак равно 0,00 гайана доллара

    5000 VEF знак равно 0.00 GYD

    5000 Венесуэльских боливаров знак равно 0,00 гайана доллара

    10000 ВЭФ знак равно 0,00 ГЙД

    10000 венесуэльских боливаров знак равно 0,00 гайана доллара

    50000 VEF знак равно 0.00 GYD

    50000 венесуэльских боливаров знак равно 0,00 гайана доллара

    100000 ВЭФ знак равно 0,00 ГЙД

    100000 венесуэльских боливаров знак равно 0,00 гайана доллара

    250000 ВЭФ знак равно 0.00 GYD

    250000 Венесуэльских боливаров знак равно 0,00 гайана доллара

    500000 ВЭФ знак равно 0,00 ГЙД

    500000 Венесуэльских боливаров знак равно 0,00 гайана доллара

    1000000 ВЭФ знак равно 0.00 GYD

    1000000 Венесуэльский боливар знак равно 0,00 гайана доллара

    5000000 ВЭФ знак равно 0,00 ГЙД

    5000000 Венесуэльский боливар знак равно 0,00 гайана доллара

    10000000 ВЭФ знак равно 0.01 GYD

    10000000 Боливар Венесуэльский знак равно 0,01 гайана доллара

    50000000 ВЭФ знак равно 0,03 ГЙД

    50000000 Венесуэльский боливар знак равно 0,03 гайана доллара

    100000000 VEF знак равно 0.05 GYD

    100000000 Венесуэльских боливаров знак равно 0,05 гайана доллара

    500000000 VEF знак равно 0,26 ГЙД

    500000000 Венесуэльский боливар знак равно 0,26 гайана доллара

    1000000000 ВЭФ знак равно 0.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *